Align aspartate aminotransferase (EC 2.6.1.1) (characterized)
to candidate WP_015819313.1 TERTU_RS12685 aspartate/tyrosine/aromatic aminotransferase
Query= metacyc::MONOMER-13012 (397 letters) >NCBI__GCF_000023025.1:WP_015819313.1 Length = 391 Score = 410 bits (1054), Expect = e-119 Identities = 200/392 (51%), Positives = 271/392 (69%), Gaps = 4/392 (1%) Query: 1 MFSVLKPLPTDPILGLMAAYKQDTNPNKIDLGVGVYKDELGNTPVLKAVKKAEAFRLENE 60 MF L+PL DPILG++A + D NKIDLGVGVY+DE GNTP+L AVK+AE Sbjct: 1 MFESLQPLAADPILGVIAQFNNDPRNNKIDLGVGVYRDEQGNTPILAAVKRAEEMLFAES 60 Query: 61 TSKSYIGLAGNLDYCQKMESLLLGEHKTLLANRVRTAQAPGGTGALRVAAEFIMRCNPKA 120 T+K+Y+G GN+ + Q + LLLG+ ++ + Q PGG GALRVAAEFI R NP A Sbjct: 61 TTKAYVGPLGNIQFNQLLAGLLLGDAHPSTSS-LSLVQTPGGCGALRVAAEFIKRSNPSA 119 Query: 121 TVWVTTPTWANHISLFEAAGLTVKEYPYYDYENKDLLFDEMINTLKQVPKGDVVLLHACC 180 T+WV+ PTW NH+ L AG+ ++ YPYYD+ L FDEM++ L++V GD+VLLHACC Sbjct: 120 TIWVSDPTWGNHVPLLGDAGINLRSYPYYDFATHTLKFDEMMSALEEVKPGDLVLLHACC 179 Query: 181 HNPSGMDLNEAQWKVVAELAKEVGFTPLVDIAYQGFGSSLEEDARGLRILADAVEELIIC 240 HNPSG DL+ QW+ V +LA++ GF P +DIAYQGFG L+ DA G+R++ + + E I+ Sbjct: 180 HNPSGTDLSVEQWQAVVDLAQKRGFVPFIDIAYQGFGQDLDSDAYGVRLVCEQLPEAIVA 239 Query: 241 SSCSKNFGLYRERIGACSLIAKDSATADISNSVLLSVVRSIYSMPPAHGADIVNTILSST 300 SCSKNFGLYRER+GA +++++ A +++S + S+VR IYSMPP HGA IV IL+ Sbjct: 240 ISCSKNFGLYRERVGAVAVLSQAPA---VASSHIASIVRGIYSMPPDHGAAIVARILADE 296 Query: 301 ELTQMWHQELDEMRSRINGLRTQIKETLATKDIAQDFSFIERQHGMFSFLGINKEQITRL 360 +L W EL MRSRI +R + L +AQ FS IERQ GMFSFLG+ EQ+ +L Sbjct: 297 DLRNTWVNELTAMRSRIRDMRVSLVGELQKHSLAQRFSHIERQQGMFSFLGLTPEQVAKL 356 Query: 361 QKEYGIYIVGSSRVNVAGVSDANIEYFANAVA 392 E+ +Y+V SSR+N+AG++ NI FA+A++ Sbjct: 357 ADEHAVYMVESSRINLAGLTPTNIPVFADALS 388 Lambda K H 0.318 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 391 Length adjustment: 31 Effective length of query: 366 Effective length of database: 360 Effective search space: 131760 Effective search space used: 131760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory