Align Argininosuccinate lyase; ASAL; EC 4.3.2.1; Arginosuccinase (uncharacterized)
to candidate WP_015928756.1 MNOD_RS10025 adenylosuccinate lyase family protein
Query= curated2:A9FJ48 (430 letters) >NCBI__GCF_000022085.1:WP_015928756.1 Length = 451 Score = 80.9 bits (198), Expect = 8e-20 Identities = 107/349 (30%), Positives = 150/349 (42%), Gaps = 30/349 (8%) Query: 88 AIEAALVARIGDAGKKVHTGRSRNDQVLVATRLYERDALDELAENAAAGARALLDLARRE 147 A++ AL + + +AG H G + D A L RDALD +A + A L DLARR Sbjct: 88 AVQKALPSHL-EAG--FHKGTTTQDIADTALILQLRDALDLVAADLRAILAGLSDLARRH 144 Query: 148 AETPMPGYTHLQRAVPSSVGYWAASFVEGLADAIDVVRATRALVDRCPLGGAAG--FGVN 205 ET G T+ Q+A P + GY AA + G+A+ + R + LGG G G+ Sbjct: 145 RETACVGRTYGQQAAPVTFGYKAAIWALGIAEVAAGLPRLRDSLLTASLGGPVGTLAGLK 204 Query: 206 LPLDRVGVARELGFAGVALNPLASQTSRGIIEAQILAAAW--QVMAVSRRLAWDLSLFAM 263 D VG R G+ +P T R I A W +M +LA D++ A Sbjct: 205 EHADAVG-ERFAAELGLRFDPAPWHTRRARIAE---AGTWLALLMGALAKLATDVASLAS 260 Query: 264 SELAFIRLP-EAFTTGSSIMPQKRNPDVVELMRAACSVVQGALAEVQSIVAL----PSG- 317 +E+ + P GSS MP KRNP ++ AA S +G + + +A P+G Sbjct: 261 TEVGEVAEPFVPGRGGSSAMPHKRNPVSSTVILAAFSAGKGQVLPLLDAMAAAHERPAGA 320 Query: 318 YHRDLQLTKGPTMRGLDEALATSRLLPRLVEGLAFDRERMAR--AITPECFATDRAVELA 375 +H + PT+ GL A R L EGL D +RM +T D A Sbjct: 321 WHAEWHAL--PTLFGL--ASGALREARALAEGLVPDPDRMRANLDLTRGLLFADAAAARL 376 Query: 376 VEGVPFREAYRKVAAEIAAL--PAGDAAASLRAR-----VSLGAPGNLA 417 + A+R V A+ G A LRAR + LG +LA Sbjct: 377 APRLGAEAAHRLVEEAAGAVRDGKGTLAEVLRARPEAAGIDLGPAFDLA 425 Lambda K H 0.320 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 34 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 451 Length adjustment: 32 Effective length of query: 398 Effective length of database: 419 Effective search space: 166762 Effective search space used: 166762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory