Align Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 (characterized)
to candidate WP_015931106.1 MNOD_RS21685 glutamate--tRNA ligase
Query= SwissProt::Q8DLI5 (485 letters) >NCBI__GCF_000022085.1:WP_015931106.1 Length = 447 Score = 244 bits (622), Expect = 6e-69 Identities = 181/454 (39%), Positives = 227/454 (50%), Gaps = 33/454 (7%) Query: 5 VRLAPSPTGNLHIGTARTAVFNWLYARHRGGKFILRIEDTDRERSRPEYTENILEGLQWL 64 VR APSPTG LHIG ARTA+FN L+AR GG F+LR++DTD RS PE+ I E L+WL Sbjct: 5 VRFAPSPTGYLHIGNARTALFNALFARREGGTFVLRLDDTDTARSTPEFAAAIAEDLRWL 64 Query: 65 GLTWDEGPYFQSDRLDLYRQAIQTLLDKGLAYYCYCTPEELEALRAEQKAKGQAPRYDNR 124 G+ D QSDR+ LY A + L G Y Y TP+ELE R Q +GQ P YD Sbjct: 65 GIAPDRS-VRQSDRIALYDAAAERLRASGRLYPAYETPDELERRRRRQLGRGQPPVYDRA 123 Query: 125 HRHLTPEEQAAFEAAGRTPVIRFKIEDDRQIEWQDLVRGRVSWQGADLGGDMVIARAAPR 184 LT E+ A EA GR P RF++ D + W DLVRG + L D V+ R Sbjct: 124 ALRLTQAERTALEAEGRRPHWRFRL-DPGPVTWTDLVRGPCHVEAESL-SDPVLVR---- 177 Query: 185 GEIGYPLYNLVVVVDDIAMGITDVIRGEDHIGNTPKQILLYEALGATPPNFAHTPLILNS 244 E G LY L VVDD MGIT VIRGEDH+ NT QI ++ ALGA P FAH L+ + Sbjct: 178 -EDGSYLYTLPSVVDDAEMGITHVIRGEDHVTNTAVQIQIFAALGAPVPVFAHHNLLTTA 236 Query: 245 TGQKLSKRDGVTSISDFRAMGYLAPALANYMTLLGWSPPEGVGELFTLDLAAKHFSFERI 304 +G+ LSKR G S+ RA GY A+A+ L G E V + LD A+ + Sbjct: 237 SGEGLSKRLGHLSLRGLRADGYEPGAVASLAVLTG--SAEAVRAVADLDELARLLDLAHV 294 Query: 305 NKAGARFDWDKLNWLNRQYIQQLEPEEFLAELIPLWQGAGYAFDEERDRPWLFDLAQLLQ 364 ++A A+FD L+ LN + I ++ E L L L A + W ++ Sbjct: 295 SRAPAKFDPHDLDQLNARIIHGMDAAEALPRLAALGIPPARA-----EAFW-----TAVR 344 Query: 365 PGLNTLREAIDQGAVFFIPSVTFDSEAMAQLGQPQSATILAYLLEHLPAEPALTVAMGQQ 424 L L +A V + M + A A LL P + A G Sbjct: 345 ANLTKLSDAAAWWRV-------VEGPVMPVVADAAFAAQAAALLPPEPWDGGTWKAWG-- 395 Query: 425 LIQQAAKA-AGVKKGATMRTLRAALTGAVHGPDL 457 A KA G+K A LR ALTG HGPDL Sbjct: 396 ---DAVKARIGLKGKALFLPLRLALTGLDHGPDL 426 Lambda K H 0.320 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 561 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 485 Length of database: 447 Length adjustment: 33 Effective length of query: 452 Effective length of database: 414 Effective search space: 187128 Effective search space used: 187128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory