Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_015931116.1 MNOD_RS21735 aspartate aminotransferase family protein
Query= curated2:Q8TUZ5 (389 letters) >NCBI__GCF_000022085.1:WP_015931116.1 Length = 443 Score = 223 bits (567), Expect = 1e-62 Identities = 148/424 (34%), Positives = 216/424 (50%), Gaps = 56/424 (13%) Query: 21 TLVPGEGARVWDDEGNEYIDLVAGIAVNVLGHCHPAVVEAVKEQVERLIHCSNLYYNEPQ 80 T G G ++D EG YID G AV+ LGH HP V+ A+ Q +RL + ++ Sbjct: 15 TATGGRGVELFDQEGRAYIDASGGAAVSCLGHGHPDVIAALHAQADRLAYAHTSFFTSEP 74 Query: 81 AEA-ARLLAEAAPKDLNKVFFCNSGTESVECAIKLARKF------TGCTKFIAFEGGFHG 133 AEA A L AP DL+ V+F + G+E+VE A+K+AR++ G ++ +A +HG Sbjct: 75 AEALAERLVTDAPADLDYVYFVSGGSEAVEAALKMARQYFVEIGQPGRSRIVARRQSYHG 134 Query: 134 RTMGALSATWKPEFREPFEPLVPEFEHVP----------------YG--DVNAVEKAI-- 173 T+GAL+A R F PL+ E H+ YG A+E + Sbjct: 135 NTLGALAAGGNEWRRAQFRPLLIETHHIDPCYAYRYQRPGESEAEYGLRAAQALEDKLLE 194 Query: 174 --DDDTAAVIVEPVQGEAGVRIPPE-GFLRELRELCDEHGLLLIVDEVQSGMGRTGQFFA 230 + A + EPV G +P G+LR +RE+CD +G+LLI+DEV GMGRTG A Sbjct: 195 LGPETVMAFVAEPVVGATAGAVPAATGYLRRVREICDRYGVLLILDEVMCGMGRTGTLHA 254 Query: 231 FEHEDVLPDIVCLAKGLGGGV-PVGATIAREEVAEAFEPG----DHGSTFGGNPLACAAV 285 E + V PD++ +AKGLGGG P+GAT + +AF G HG T+ +P+ACAA Sbjct: 255 CEQDGVAPDLMPVAKGLGGGYQPIGATFLSGRIYDAFANGSGLFQHGHTYICHPMACAAA 314 Query: 286 CAAVSTVLEENLPEAAERKGKLAMRILSEA---EDVVEEVRGRGLMMGVEVGDDERAK-- 340 A + ENL + + G+ R L+E V ++RGRGL MGVE+ +D +K Sbjct: 315 LAVQEVIARENLLDNVKAMGRHLRRRLTERFGNHPHVGDIRGRGLFMGVELVEDRGSKAP 374 Query: 341 ---------DVAREMLDR-------GALVNVTSGDVIRLVPPLVIGEDELEKALAELADA 384 V RE ++R G ++ GD + L PP +I ++ + L +A Sbjct: 375 FAPALKLNGRVKREAMERGLAVYPAGGTIDGVHGDHVLLAPPFIIDAATVDTIVERLGEA 434 Query: 385 LRAS 388 L A+ Sbjct: 435 LDAA 438 Lambda K H 0.318 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 24 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 443 Length adjustment: 31 Effective length of query: 358 Effective length of database: 412 Effective search space: 147496 Effective search space used: 147496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory