Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate WP_015931304.1 MNOD_RS22695 aminotransferase class V-fold PLP-dependent enzyme
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >NCBI__GCF_000022085.1:WP_015931304.1 Length = 431 Score = 221 bits (564), Expect = 2e-62 Identities = 141/423 (33%), Positives = 217/423 (51%), Gaps = 14/423 (3%) Query: 3 DKKTYGFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGRQG 62 D F T +H+ G+ +PI+ + F +E Q A++F + G+ Y R Sbjct: 5 DPSALAFATRAVHAGTAPDPATGARAQPIYFTNGFVFESNEQAADIFAMRATGFSYSRGS 64 Query: 63 NPTVAALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNTNSLWMT 122 NPTVAALE ++ +E K+ + ++G +A+ ++ L++ GD VS+A LFG + L Sbjct: 65 NPTVAALERRVASLEGAKAAVAVSSGQSAMLLVLLTLMQAGDAYVSAARLFGGSLGLMRR 124 Query: 123 VGAQ-GAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGILY 181 + + G + ++ EAAIT TR++ E+I NP V D+ + + R G+ Sbjct: 125 LETRYGLTPQFTRGLNPEDFEAAITDKTRVIVCESIVNPCGTVVDIAGVAAVARRHGLPL 184 Query: 182 VVDNTMTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDWT---RYPHIAE 238 VVDNT+ SP L RP GA +VV+S +K + G G +GG + D G FDW RY I E Sbjct: 185 VVDNTLASPALIRPIEYGADIVVHSTSKFLSGSGTVIGGIVCDAGRFDWKATGRYNLINE 244 Query: 239 NYK-------KNPAPQWGMA-QIRAKALRDFGGSLGPEAAHHIAVGAETIALRQERECKN 290 + + P+ A R LRD G L P A G ET+ LR ER C N Sbjct: 245 PWPDYEGLVVSDRFPETAFAVACRLFGLRDLGPGLSPMNAFLTLTGIETLPLRMERHCAN 304 Query: 291 ALALAQMLQADERVAAVYYPGLESHPQHAL-SKALFRSFGSLMSFELKDGID-CFDYLNR 348 A A+A L+A +VA V YP L A+ ++ + GS+ +F LK G D+++ Sbjct: 305 ARAVAAFLKAHPKVAWVSYPSLPGQAGEAVANRYVPNGAGSIFTFALKGGEQAALDFISG 364 Query: 349 LRLAIPTSNLGDTRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDDLVADFR 408 L L N+G+ ++L I A T ++ + +A+ + +R+S+GLE +DL+AD Sbjct: 365 LELISHLVNIGEIKSLAIHPATTTHRQLRDDEKAAACVGPETVRLSIGLETIEDLIADIE 424 Query: 409 QAL 411 QAL Sbjct: 425 QAL 427 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 431 Length adjustment: 32 Effective length of query: 381 Effective length of database: 399 Effective search space: 152019 Effective search space used: 152019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory