Align 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 (characterized)
to candidate WP_015931475.1 MNOD_RS23550 dihydrodipicolinate synthase family protein
Query= SwissProt::Q9JZR4 (291 letters) >NCBI__GCF_000022085.1:WP_015931475.1 Length = 299 Score = 147 bits (370), Expect = 4e-40 Identities = 93/286 (32%), Positives = 141/286 (49%), Gaps = 1/286 (0%) Query: 4 GSLVALITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVIEAV 63 G L+TP DGSI+ + + LID I NG G+VA G+TGE L+ E + + Sbjct: 8 GIFAVLVTPFGADGSINETRYKALIDDAIANGAQGVVAAGSTGEFYALTKAERARLFKLA 67 Query: 64 VKHVAKRVPVIAGTGANNTVEAIALSQAAEKAGADYTLSVVPYYNKPSQEGIYQHFKTIA 123 V H A+RVPV+AG + + Q+A AG L + P Y PS + F I+ Sbjct: 68 VDHAARRVPVLAGVADLRVEDVLEACQSAVAAGCAGGLILPPIYAMPSPREVVAFFAHIS 127 Query: 124 EATSIPMIIYNVPGRTVVSMTNDTILRLAEIPNIVGVKEASGNIGSNIELINRAPEGFVV 183 T +P+++YN P R +++T + +L+ +P +V +K++SG+I EL+ R + V Sbjct: 128 RNTPLPLMLYNSPRRAGINLTPALVEQLSALPTVVAIKDSSGDITQVSELVQRVGDNLRV 187 Query: 184 LSGDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAALQGDIALARELNDRLIPIYDTM 243 G + + G HGVI +A A L AL GD AL +L + +Y Sbjct: 188 FVGYEDMIVRARAVGAHGVIAMAHQIAGPLIRAYWDKALSGDKAL-EDLGRDVCALYRCF 246 Query: 244 FCEPSPAAPKWAVSALGRCEPHVRLPLVPLTENGQAKVRAALKASG 289 AA K +S LGR RLPL+PL + +A + + +G Sbjct: 247 QSGSYYAAIKETMSQLGRDAGGPRLPLLPLADEQKAAIAKIIADAG 292 Lambda K H 0.317 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 299 Length adjustment: 26 Effective length of query: 265 Effective length of database: 273 Effective search space: 72345 Effective search space used: 72345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory