Align N-acetylglutamylphosphate reductase (EC 1.2.1.38) (characterized)
to candidate WP_015931791.1 MNOD_RS25255 N-acetyl-gamma-glutamyl-phosphate reductase
Query= reanno::Smeli:SMc01801 (310 letters) >NCBI__GCF_000022085.1:WP_015931791.1 Length = 315 Score = 300 bits (768), Expect = 3e-86 Identities = 163/311 (52%), Positives = 204/311 (65%), Gaps = 10/311 (3%) Query: 2 KPKIFIDGEHGTTGLQIRVRMAGRTDLELLSIPEAERRNAAMREDLLNSADIAILCLPDD 61 +P +FIDGE GTTGL IR R+ D+ L SIP +R++ A + LL D+ +LCLPDD Sbjct: 8 RPSVFIDGEAGTTGLGIRERLEAFDDIALRSIPHEQRKDPAAKRTLLAEVDLVVLCLPDD 67 Query: 62 ASREAVAMVAG--NNRVRIIDTSTAHRVAPDWAYGFAEMDKAQPQRIRDARHVANPGCYP 119 A+RE VAM G RI+D STAHRVAP W YGFAEM Q +R AR VANPGCYP Sbjct: 68 AARETVAMADGLPGGGPRILDASTAHRVAPGWTYGFAEMTPDQRAALRAARRVANPGCYP 127 Query: 120 TGAIALIRPLRQAGILPDGYPVTVNAVSGYTGGGKQMIAQMEDDQNPDHIGAPHF-LYGL 178 TGAIAL+RPL AG++P +PV++NAVSGY+GGG++MI E AP F LYGL Sbjct: 128 TGAIALLRPLVDAGLIPADFPVSINAVSGYSGGGRKMIEAYEAGT------APAFELYGL 181 Query: 179 TLKHKHVPEMKMHGLLERAPVFSPSVGKFAQGMIVQVPLYLEDLAAGATLETIHRALVDH 238 HKH+PE + + L R P+F PSVG F QGM+V +PL+L+ L T + AL Sbjct: 182 GFAHKHLPETQTYSRLTRRPIFIPSVGNFRQGMLVSIPLHLDALPGRPTAGDLEAALQAR 241 Query: 239 YAGQSIVEVVP-LDESAKLARIDATELAGSDAMKLFVFGTKGGAHVNLVALLDNLGKGAS 297 YAG+ +V VVP ++ A RI+ L +D ++L VFG+ A LVA LDNLGKGAS Sbjct: 242 YAGEELVRVVPGAEDGAHRERIEPEALNDTDRLELRVFGSDAQAQAVLVARLDNLGKGAS 301 Query: 298 GAAVQNMDLML 308 GAAVQN+ LML Sbjct: 302 GAAVQNLRLML 312 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 315 Length adjustment: 27 Effective length of query: 283 Effective length of database: 288 Effective search space: 81504 Effective search space used: 81504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_015931791.1 MNOD_RS25255 (N-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01851.hmm # target sequence database: /tmp/gapView.22115.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01851 [M=310] Accession: TIGR01851 Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-126 405.6 0.0 8.2e-126 405.4 0.0 1.0 1 lcl|NCBI__GCF_000022085.1:WP_015931791.1 MNOD_RS25255 N-acetyl-gamma-glut Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000022085.1:WP_015931791.1 MNOD_RS25255 N-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.4 0.0 8.2e-126 8.2e-126 2 309 .. 9 313 .. 8 314 .. 0.96 Alignments for each domain: == domain 1 score: 405.4 bits; conditional E-value: 8.2e-126 TIGR01851 2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaareavslvd 70 p vfidGeaGttGl irerl dd+ l si +++rkd++++ ll +d ++lclpddaare+v++ d lcl|NCBI__GCF_000022085.1:WP_015931791.1 9 PSVFIDGEAGTTGLGIRERLEAFDDIALRSIPHEQRKDPAAKRTLLAEVDLVVLCLPDDAARETVAMAD 77 78*****************************************************************99 PP TIGR01851 71 n...pntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatgaiallrPlveaGilPad 136 +ildasta+r+a++w+yGf+e++++qr +++a+rvanPGcy+tgaiallrPlv+aG++Pad lcl|NCBI__GCF_000022085.1:WP_015931791.1 78 GlpgGGPRILDASTAHRVAPGWTYGFAEMTPDQRAALRAARRVANPGCYPTGAIALLRPLVDAGLIPAD 146 63225679************************************************************* PP TIGR01851 137 fPvtinavsGysGGGkaliakyeeesaddskkaafiiyglalehkhlpemrkhsglaskPiftPavGdf 205 fPv+inavsGysGGG+++i++ye + af ygl + hkhlpe++++s+l+++Pif+P+vG+f lcl|NCBI__GCF_000022085.1:WP_015931791.1 147 FPVSINAVSGYSGGGRKMIEAYEA-----GTAPAFELYGLGFAHKHLPETQTYSRLTRRPIFIPSVGNF 210 ***********************2.....334689********************************** PP TIGR01851 206 aqGllveiplhlaeldskvsaedihkalaeyykGekfvkvaelddaellddtildaqglngtnrlelfv 274 qG+lv iplhl l ++++a d+++al+ y+Ge+ v+v++ ++ + + +++++ln+t+rlel v lcl|NCBI__GCF_000022085.1:WP_015931791.1 211 RQGMLVSIPLHLDALPGRPTAGDLEAALQARYAGEELVRVVPGAEDGAH-RERIEPEALNDTDRLELRV 278 ******************************************9999866.5778*************** PP TIGR01851 275 fgsddgerallvarldnlGkGasGaavqnlnialG 309 fgsd+ +a+lvarldnlGkGasGaavqnl ++l lcl|NCBI__GCF_000022085.1:WP_015931791.1 279 FGSDAQAQAVLVARLDNLGKGASGAAVQNLRLMLD 313 *********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (310 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.89 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory