Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_015931910.1 MNOD_RS25840 methionine gamma-lyase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000022085.1:WP_015931910.1 Length = 429 Score = 211 bits (538), Expect = 3e-59 Identities = 138/396 (34%), Positives = 203/396 (51%), Gaps = 25/396 (6%) Query: 33 EGEHGEALFTTSSYVFRTAADAAARF----------AGEVPGNVYSRYTNPTVRTFEERI 82 EG +F TS++ F +A A F GE G VYSR+ +P E+R+ Sbjct: 33 EGAVKPPVFLTSTFAFTSAEHGKAFFDYVSGRREPPKGEAAGLVYSRFNHPNSEIVEDRL 92 Query: 83 AALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGI-QVD 141 A E AE A+ +SGMSAI +++ GD VL S+ ++G T +L K FGI V Sbjct: 93 AVFEEAESALLFSSGMSAIATTILAFARPGDVVLHSQPLYGGTETLIAKTLSGFGIGAVG 152 Query: 142 YPPLSDLAAWEAACKP-----NTKLFFVESPSNPLAELVDIAALA----EIAHAKGALLA 192 + +D A+ AA + VE+PSNPL LVD+A + EI A+GA Sbjct: 153 FANGTDPASVRAAAASAREAGRVSVVMVETPSNPLNTLVDLALVRRVADEIGTAQGAAAP 212 Query: 193 V---DNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVVGFLRTA 249 V DN P Q PL+ GAD+ ++S TKY+ G + G G +M+ V Sbjct: 213 VVICDNTLLGPLFQHPLRHGADISVYSLTKYVGGHSDLIAGAALGSAARMRPVRLLRSAI 272 Query: 250 GPTLSPFNAWLFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGL--PSHPQHE 307 G L P + W+ + LETL +RM A S + +A L R P + R+++ P P + Sbjct: 273 GTQLDPHSCWMIGRSLETLTLRMSAASRNGEQVAAMLRRHPKVTRLHHLSHLEPGSPAAQ 332 Query: 308 LARRQQSGFGAVVSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSP 367 + Q + G+ SFDV GG A+R ++A ++ + +LG T++ HPA+T+H + Sbjct: 333 VYAAQCTAPGSTFSFDVAGGEAEAFRVLNALQLFKLAVSLGGTESLACHPASTTHSGVPK 392 Query: 368 EDRARAGIGDSLIRVAVGLEDLDDLKADMARGLAAL 403 E R R G+ D+ IRV++G+E DDL AD+ LA L Sbjct: 393 EVRDRLGVTDATIRVSIGIEHPDDLIADLTAALAIL 428 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 429 Length adjustment: 31 Effective length of query: 372 Effective length of database: 398 Effective search space: 148056 Effective search space used: 148056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory