Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate WP_015932020.1 MNOD_RS26380 anthranilate synthase component I
Query= SwissProt::P20579 (493 letters) >NCBI__GCF_000022085.1:WP_015932020.1 Length = 504 Score = 380 bits (977), Expect = e-110 Identities = 228/484 (47%), Positives = 296/484 (61%), Gaps = 15/484 (3%) Query: 19 LACETLADFDTPLSIYLKL--ADQPNSYLLESVQGGEKWGRYSMIGLPSRTVMRVHGYHV 76 L +AD +TP++ +LKL + ++LLESV+GG GRYSMIGL V R G Sbjct: 22 LRATLVADLETPVAAFLKLKAGREGAAFLLESVEGGAVRGRYSMIGLDPDLVWRCSG-GT 80 Query: 77 SILHDGVEVESHDVEDPLAFVESFKDRYKVADIPG---LPRFNGGLVGYFGYDCVRYVEK 133 + D +++ V D ++S +D + IPG LP GL GY GYD VR +E+ Sbjct: 81 AERADAPDLDRF-VPDDRPPLDSLRDLIAESAIPGDAALPPMAAGLFGYLGYDMVREMER 139 Query: 134 RLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAIVLVDPAEEQ----AFEQGQARLQ 189 P PDP+GVPD +L+ +VVFD + ++ + + P Q A E RL+ Sbjct: 140 L--DPPKPDPIGVPDAILVRPTVMVVFDAVRDEIAVVTPLRPVPGQPAKAACEAALNRLE 197 Query: 190 GLLETLRQPITPRRGLDLSGPQAAEPEFRSSYTREDYENAVGRIKEYILAGDCMQVVPSQ 249 + ETL P+ + + A P S+ T E++ V R K YI AGD QVV SQ Sbjct: 198 RVAETLEGPLPVEAWANPTEIPAPAPV--SNTTPEEFHAMVARAKAYIAAGDIFQVVLSQ 255 Query: 250 RMSIDFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDNLVTVRPIAGT 309 R F LYR+LR NP P++ + +FG F +V SSPE+LVRV D VT+RPIAGT Sbjct: 256 RFEAPFALPAFALYRSLRRVNPAPFLCYLDFGTFQIVCSSPEILVRVRDGKVTIRPIAGT 315 Query: 310 RPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGRNDVGRVSSTGSVRLTEKMVIERYSN 369 R RGAT E D AL ++LL+D KE AEHLML+DLGRNDVGRV+ GSV +T+ +E YS Sbjct: 316 RRRGATPEEDGALAEELLADPKERAEHLMLLDLGRNDVGRVAQIGSVTVTDSFFLEYYSQ 375 Query: 370 VMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGY 429 VMHIVSNV G+L A+ AL A PAGT+SGAPK+RAM+IIDELE KRG Y G +GY Sbjct: 376 VMHIVSNVEGRLDPRHDALGALVAGFPAGTVSGAPKVRAMQIIDELEREKRGPYAGCIGY 435 Query: 430 FAWNGNMDTAIAIRTAVINDGELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQ 489 F +G MDT I +RTAV+ DG +HVQAG GIV DS PA E +E +NK +A FRA A + Sbjct: 436 FGADGQMDTCIVLRTAVVKDGRMHVQAGAGIVHDSDPASEQQECVNKAKAQFRAAEEAVR 495 Query: 490 TSAK 493 +A+ Sbjct: 496 FAAQ 499 Lambda K H 0.320 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 711 Number of extensions: 42 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 504 Length adjustment: 34 Effective length of query: 459 Effective length of database: 470 Effective search space: 215730 Effective search space used: 215730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_015932020.1 MNOD_RS26380 (anthranilate synthase component I)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.6861.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-172 559.3 0.0 4.3e-172 559.1 0.0 1.0 1 lcl|NCBI__GCF_000022085.1:WP_015932020.1 MNOD_RS26380 anthranilate syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000022085.1:WP_015932020.1 MNOD_RS26380 anthranilate synthase component I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 559.1 0.0 4.3e-172 4.3e-172 1 454 [. 28 490 .. 28 491 .. 0.94 Alignments for each domain: == domain 1 score: 559.1 bits; conditional E-value: 4.3e-172 TIGR00564 1 adtltpisvylklak..rkesfllEsvekeeelgRySliglnpvleikakdgkavlleaddeeak..ie 65 ad +tp+ ++lkl+ + + fllEsve ++ +gRyS+igl+p+l++++++g+a++++a d + + lcl|NCBI__GCF_000022085.1:WP_015932020.1 28 ADLETPVAAFLKLKAgrEGAAFLLESVEGGAVRGRYSMIGLDPDLVWRCSGGTAERADAPDLDRFvpDD 96 5889**********9844789*******************************99999987765554577 PP TIGR00564 66 edelkelrkllekaeesedeldeplsggavGylgydtvrlveklkeeaedelelpdlllllvetvivfD 134 +l++lr+l+++ ++ d +p+++g++Gylgyd+vr +e+l ++++d++ +pd++l+ + ++vfD lcl|NCBI__GCF_000022085.1:WP_015932020.1 97 RPPLDSLRDLIAESAIPGDAALPPMAAGLFGYLGYDMVREMERLDPPKPDPIGVPDAILVRPTVMVVFD 165 789**********98888888899********************************************* PP TIGR00564 135 hvekkvilienarteaers...aeeeaaarleellaelqkeleka...vkaleekkesftsnvekeeye 197 +v++++ +++ r ++ a e+a +rle+++++l+ +l + +++ e + sn++ ee++ lcl|NCBI__GCF_000022085.1:WP_015932020.1 166 AVRDEIAVVTPLRPVPGQPakaACEAALNRLERVAETLEGPLPVEawaNPT-EIPAPAPVSNTTPEEFH 233 **********9998776655568899999*********9999876553333.34444466999****** PP TIGR00564 198 ekvakakeyikaGdifqvvlSqrleakveakpfelYrkLRtvNPSpylyyldledfelvgsSPEllvkv 266 + va+ak yi+aGdifqvvlSqr+ea++ +++f+lYr+LR+vNP+p+l yld+ f++v sSPE+lv+v lcl|NCBI__GCF_000022085.1:WP_015932020.1 234 AMVARAKAYIAAGDIFQVVLSQRFEAPFALPAFALYRSLRRVNPAPFLCYLDFGTFQIVCSSPEILVRV 302 ********************************************************************* PP TIGR00564 267 kgkrvetrPiAGtrkRGatkeeDealeeeLladeKerAEHlmLvDLaRNDigkvaklgsvevkellkie 335 ++ +v++rPiAGtr+RGat+eeD al+eeLlad+KerAEHlmL+DL+RND+g+va++gsv v++++ +e lcl|NCBI__GCF_000022085.1:WP_015932020.1 303 RDGKVTIRPIAGTRRRGATPEEDGALAEELLADPKERAEHLMLLDLGRNDVGRVAQIGSVTVTDSFFLE 371 ********************************************************************* PP TIGR00564 336 kyshvmHivSeVeGelkdeltavDalraalPaGTlsGAPKvrAmelidelEkekRgiYgGavgylsfdg 404 ys vmHivS+VeG+l + +a+ al a +PaGT+sGAPKvrAm++idelE ekRg+Y+G++gy+++dg lcl|NCBI__GCF_000022085.1:WP_015932020.1 372 YYSQVMHIVSNVEGRLDPRHDALGALVAGFPAGTVSGAPKVRAMQIIDELEREKRGPYAGCIGYFGADG 440 ********************************************************************* PP TIGR00564 405 dvdtaiaiRtmvlkdgvayvqAgaGiVaDSdpeaEyeEtlnKakallrai 454 ++dt+i++Rt+v+kdg+++vqAgaGiV DSdp +E +E++nKaka+ ra+ lcl|NCBI__GCF_000022085.1:WP_015932020.1 441 QMDTCIVLRTAVVKDGRMHVQAGAGIVHDSDPASEQQECVNKAKAQFRAA 490 **********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (504 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 7.34 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory