Align histidinol-phosphate aminotransferase [EC:2.6.1.9] (characterized)
to candidate WP_015932244.1 MNOD_RS27455 histidinol-phosphate aminotransferase
Query= reanno::azobra:AZOBR_RS20485 (364 letters) >NCBI__GCF_000022085.1:WP_015932244.1 Length = 370 Score = 369 bits (946), Expect = e-107 Identities = 189/363 (52%), Positives = 249/363 (68%), Gaps = 13/363 (3%) Query: 8 PAPRPGILDIAPYVGGEHAGHI-----RLASNEGALGPSPRAVEAYRAAAGELHRYPDGG 62 P PRPG+L+I YV G+ A +L+SNE LGPS A+ A R L YPDG Sbjct: 7 PVPRPGVLEIEAYVPGKSAAPAGVKLHKLSSNETPLGPSLAAIAAMRETGAHLELYPDGS 66 Query: 63 SAKLRKAIAERFGLDADRVVCGAGSDELIALLIRAYAGPGDEVLYSQHGFLMYPIGAKSV 122 + LR+AIA ++GLD +R+VCGAGSDEL++LL AY GPGDE +YSQ+GFL+Y I + Sbjct: 67 ATDLRRAIAGKYGLDPERIVCGAGSDELLSLLTYAYLGPGDEGVYSQYGFLVYRIAILAA 126 Query: 123 GATPVQAPETNLTTDVDSLLAHVTPRTRLVFVANPNNPTGTYITADEMARLHAGLPENAI 182 G TPV APE + T DVD++L VTPRTR+V++ANPNNPTGTY+ DE+ RLHAGLP N + Sbjct: 127 GGTPVVAPERDHTADVDAILKAVTPRTRIVYLANPNNPTGTYLPFDEVRRLHAGLPGNVL 186 Query: 183 LVIDAAYAEYMNHNDYSAGQELVDRFPNVVMTRTFSKIFALGSVRLGWAYCPAGIADVLN 242 LV+DAAYAEY+ NDY+AG ELV NVVMTRTFSK++ L ++R+GW PA + D +N Sbjct: 187 LVLDAAYAEYVRRNDYAAGLELVAESENVVMTRTFSKVYGLAALRIGWMVAPAAVVDAVN 246 Query: 243 RVRGPFNVSSAAQIAGVAALEDTAFLERSRSHNIEWREWFVQQVHGLGLKTHPSVTNFVL 302 R+RGPFN+S+AA AG AA+ D A + + +HN W + + LGL+ PSV NFVL Sbjct: 247 RIRGPFNLSTAAIAAGTAAIADDAHIAAAVAHNDAWLPKVTRALTDLGLQVTPSVGNFVL 306 Query: 303 VDF---AGQTAGKDDAEAARLFLKGRGILVRQMPAYGLPSCLRVTIGTEAEMREVVQALK 359 + F G++A DA FL RG+++R++ AYGLP+ LR+TIG+ V+ AL Sbjct: 307 IHFPDAPGRSAADADA-----FLTARGLILRRVGAYGLPNALRMTIGSAEANEAVIAALG 361 Query: 360 DFL 362 DF+ Sbjct: 362 DFM 364 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 446 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 370 Length adjustment: 30 Effective length of query: 334 Effective length of database: 340 Effective search space: 113560 Effective search space used: 113560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_015932244.1 MNOD_RS27455 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.9492.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-87 277.1 0.0 1e-86 277.0 0.0 1.0 1 lcl|NCBI__GCF_000022085.1:WP_015932244.1 MNOD_RS27455 histidinol-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000022085.1:WP_015932244.1 MNOD_RS27455 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 277.0 0.0 1e-86 1e-86 1 347 [. 10 361 .. 10 363 .. 0.95 Alignments for each domain: == domain 1 score: 277.0 bits; conditional E-value: 1e-86 TIGR01141 1 rekikklepYqpgarelgek.evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealakyl 68 r+ + ++e+Y+pg+++ + + kL+snE P+gps ++++a++e+ ++l++Ypd +a++l++a+a ++ lcl|NCBI__GCF_000022085.1:WP_015932244.1 10 RPGVLEIEAYVPGKSAAPAGvKLHKLSSNETPLGPSLAAIAAMRETGAHLELYPDGSATDLRRAIAGKY 78 5678899******66655555799**********************9********************** PP TIGR01141 69 gveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedleavl 137 g+++e i+ g+Gsdel++ll+ a+l pgd+ +++++ + +Y++ +ag + +p +++ + d++a+l lcl|NCBI__GCF_000022085.1:WP_015932244.1 79 GLDPERIVCGAGSDELLSLLTYAYLGPGDEGVYSQYGFLVYRIAILAAGGTPVVAPERDH-TADVDAIL 146 *******************************************99999888888887777.59****** PP TIGR01141 138 eaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeypnl 202 +a++ ++++v+la+PnnPtG++l +e++++ + ++l V+D AY e+ ++ a lel+ae +n+ lcl|NCBI__GCF_000022085.1:WP_015932244.1 147 KAVTPRTRIVYLANPNNPTGTYLPFDEVRRLHAGLpGNVLLVLDAAYAEYVRRndyAAGLELVAESENV 215 ***********************************77**************998888899********* PP TIGR01141 203 vvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkere 271 v++rT+SK++gLA+lR+G ++a a++++a++++r p+n+s+ a +a++aa+ d+++i++ v+++ + lcl|NCBI__GCF_000022085.1:WP_015932244.1 216 VMTRTFSKVYGLAALRIGWMVAPAAVVDAVNRIRGPFNLSTAAIAAGTAAIADDAHIAAAVAHNDAWLP 284 ********************************************************************* PP TIGR01141 272 rlleelkkleglevyeSkaNFvlikvke....daeelleallekgiivRdlksaeglleeclRitvGtr 336 ++ +l++l gl+v +S +NFvli+++ a+++ l+ +g+i+R ++++ gl +++lR+t+G++ lcl|NCBI__GCF_000022085.1:WP_015932244.1 285 KVTRALTDL-GLQVTPSVGNFVLIHFPDapgrSAADADAFLTARGLILRRVGAY-GL-PNALRMTIGSA 350 *********.8****************98887777888889***********99.85.*********** PP TIGR01141 337 eenerllealk 347 e ne++++al lcl|NCBI__GCF_000022085.1:WP_015932244.1 351 EANEAVIAALG 361 ********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.04 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory