Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_015933584.1 MNOD_RS34460 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000022085.1:WP_015933584.1 Length = 398 Score = 349 bits (896), Expect = e-100 Identities = 182/386 (47%), Positives = 254/386 (65%), Gaps = 2/386 (0%) Query: 10 DLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPSP 69 DLKGKRV++RVD NVP+++G V D TRI LPTI+ E G +V+LL+H GRPKG+P P Sbjct: 12 DLKGKRVLVRVDLNVPMENGRVTDATRITRVLPTIREIAEAGGRVVLLAHFGRPKGKPDP 71 Query: 70 EFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGETKNDPE 129 + SL P+A+ +++ LG+ V F +G + +AV L +G V +LENTRFH GE KNDP Sbjct: 72 KESLRPIAEAVAKDLGRPVAFAEDCIGPKAAEAVAALGDGGVAMLENTRFHAGEEKNDPA 131 Query: 130 LAKFWASLADIHVNDAFGTAHRAHASNVGIAQFIPSVAGFLMEKEIKFLSKVTYNPEKPY 189 + A+ D++VN+AF +HRAHAS G+A +P+ AG LM+ EI+ L+K P +P Sbjct: 132 FVQALAANGDVYVNEAFSASHRAHASTEGLAHVLPAYAGRLMQAEIEALTKGLEAPARPV 191 Query: 190 VVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKIDLAKEL 249 V ++GG+KVS KI ++ NL+ K D ++IGG M TFL A G VG S E D A + Sbjct: 192 VAIVGGSKVSTKIDLLVNLVGKVDALVIGGGMANTFLHATGLGVGRSLCERDLAGTALRI 251 Query: 250 LEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIELFKQKLS 309 +E A+EK I+LPVDAV+A++ + I D IPE M LD+G +++E L+ Sbjct: 252 IEAAREKNCAIILPVDAVVAEEFKANAPHHTYGI-DAIPESGMILDVGAQSVERVAAALN 310 Query: 310 DAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKG-AITVVGGGDSAAAVNKFGLEDK 368 DAKT+VWNGP+G FE F +GT A A T+ G ++V GGGD+ AA+N G+ + Sbjct: 311 DAKTLVWNGPLGAFEFPPFDQGTVAAARHAAERTKAGKLVSVAGGGDTVAALNHAGVAEA 370 Query: 369 FSHVSTGGGASLEFLEGKELPGIASI 394 F++VST GGA LE+LEGK LPG+ ++ Sbjct: 371 FTYVSTAGGAFLEWLEGKPLPGVDAL 396 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 613 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 398 Length adjustment: 34 Effective length of query: 620 Effective length of database: 364 Effective search space: 225680 Effective search space used: 225680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory