Align histidinol dehydrogenase (EC 1.1.1.23) (characterized)
to candidate WP_015943471.1 DHAF_RS07445 histidinol dehydrogenase
Query= BRENDA::Q8G2R2 (430 letters) >NCBI__GCF_000021925.1:WP_015943471.1 Length = 426 Score = 366 bits (939), Expect = e-106 Identities = 198/401 (49%), Positives = 269/401 (67%), Gaps = 5/401 (1%) Query: 30 VDRAVREIVDRVRREGDSALLDYSRRFDRIDLEKTGIAVTEAEIDAAFDAAPASTVEALK 89 ++ V EI+ +++EGDSAL + +FD +DL +G+ V E+ A+ + AL+ Sbjct: 25 LEHKVAEILSEIKKEGDSALYALTEKFDGVDLRPSGLRVRAEELVKAYSQVDEEFLAALR 84 Query: 90 LARDRIEKHHARQLPKDDRYTDAL--GVELGSRWTAIEAVGLYVPGGTASYPSSVLMNAM 147 LA+++I +H +Q K + DA G LG ++ VG+YVPGGTA+YPSSVLMNA+ Sbjct: 85 LAKEKITSYHEKQ--KRTSWLDAQEDGSILGQLLLPLKRVGIYVPGGTAAYPSSVLMNAV 142 Query: 148 PAKVAGVDRIVMVVPA-PDGNLNPLVLVAARLAGVSEIYRVGGAQAIAALAYGTETIRPV 206 PA VAGV+ IVMV P DG+L P VLVAA AGV+EIY+VGGAQAIAALA+GT I PV Sbjct: 143 PAVVAGVEEIVMVSPPRKDGSLLPEVLVAAAEAGVTEIYKVGGAQAIAALAFGTGEISPV 202 Query: 207 AKIVGPGNAYVAAAKRIVFGTVGIDMIAGPSEVLIVADKDNNPDWIAADLLAQAEHDTAA 266 KI GPGN YV AK+ VFGTV IDM+AGPSE+LI+AD+ P+ +AADLL+QAEHD A Sbjct: 203 DKITGPGNIYVTLAKKQVFGTVDIDMLAGPSEILILADESAQPEELAADLLSQAEHDPLA 262 Query: 267 QSILMTNDEAFAHAVEEAVERQLHTLARTETASASWRDFGAVILVKDFEDAIPLANRIAA 326 SIL++ D VERQL L R + A ASW +GA ILVKD + + L N+IA Sbjct: 263 SSILVSPDRKVLEETVAEVERQLKLLPRQDIARASWETYGAAILVKDLAEGMNLVNQIAP 322 Query: 327 EHLEIAVADAEAFVPRIRNAGSIFIGGYTPEVIGDYVGGCNHVLPTARSARFSSGLSVLD 386 EH E+ + + +++ R+RNAG++F+G ++PE +GDY G NHVLPT +ARF S L+V Sbjct: 323 EHFELVIKEPYSWLGRVRNAGAVFLGRFSPEPVGDYFAGPNHVLPTGGTARFYSPLNVDT 382 Query: 387 YMKRTSLLKLGSEQLRALGPAAIEIARAEGLDAHAQSVAIR 427 +MK+ S++ + L+ G +AR EGL+AHA++V R Sbjct: 383 FMKKVSVISYSEKALQRDGKHIAHLARKEGLEAHARAVEAR 423 Lambda K H 0.318 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 426 Length adjustment: 32 Effective length of query: 398 Effective length of database: 394 Effective search space: 156812 Effective search space used: 156812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_015943471.1 DHAF_RS07445 (histidinol dehydrogenase)
to HMM TIGR00069 (hisD: histidinol dehydrogenase (EC 1.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00069.hmm # target sequence database: /tmp/gapView.6229.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00069 [M=393] Accession: TIGR00069 Description: hisD: histidinol dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-170 551.4 0.0 8e-170 551.2 0.0 1.0 1 lcl|NCBI__GCF_000021925.1:WP_015943471.1 DHAF_RS07445 histidinol dehydrog Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021925.1:WP_015943471.1 DHAF_RS07445 histidinol dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 551.2 0.0 8e-170 8e-170 1 393 [] 29 423 .. 29 423 .. 0.99 Alignments for each domain: == domain 1 score: 551.2 bits; conditional E-value: 8e-170 TIGR00069 1 vkeiiedvrkeGdeAlleytekfdkv..kleslrvseeeleealeavdeelkealelaaeniekfhekq 67 v+ei+++++keGd+Al+++tekfd+v +++ lrv +eel +a+++vdee+ +al+la+e+i+++hekq lcl|NCBI__GCF_000021925.1:WP_015943471.1 29 VAEILSEIKKEGDSALYALTEKFDGVdlRPSGLRVRAEELVKAYSQVDEEFLAALRLAKEKITSYHEKQ 97 789**********************9778889************************************* PP TIGR00069 68 lpesveveteegvllgqkvrplervglYvPgGkaaypStvlmtavpAkvAgvkeivvvtPpkkdgkvnp 136 +++s+ +e+g++lgq++ pl+rvg+YvPgG+aaypS+vlm+avpA vAgv+eiv+v+Pp+kdg++ p lcl|NCBI__GCF_000021925.1:WP_015943471.1 98 KRTSWLDAQEDGSILGQLLLPLKRVGIYVPGGTAAYPSSVLMNAVPAVVAGVEEIVMVSPPRKDGSLLP 166 ********************************************************************* PP TIGR00069 137 avlaaakllgvdevykvGGaqaiaalayGtetvpkvdkivGPGniyVtaAKklvfgevgidmiaGPsEv 205 +vl+aa+ +gv+e+ykvGGaqaiaala+Gt ++++vdki+GPGniyVt AKk+vfg+v+idm+aGPsE+ lcl|NCBI__GCF_000021925.1:WP_015943471.1 167 EVLVAAAEAGVTEIYKVGGAQAIAALAFGTGEISPVDKITGPGNIYVTLAKKQVFGTVDIDMLAGPSEI 235 ********************************************************************* PP TIGR00069 206 lviadesanpelvaaDllsqaEHdedaqailvttseelaekveeeveeqleelerkeiaekslekngai 274 l++adesa+pe +aaDllsqaEHd+ a++ilv+++++++e++ +eve+ql+ l+r++ia++s+e++ga lcl|NCBI__GCF_000021925.1:WP_015943471.1 236 LILADESAQPEELAADLLSQAEHDPLASSILVSPDRKVLEETVAEVERQLKLLPRQDIARASWETYGAA 304 ********************************************************************* PP TIGR00069 275 ilvddleealelsneyApEHLelqtkdpeellkkiknaGsvflGeytpealgdyvaGpnhvLPTsgtAr 343 ilv+dl+e ++l+n++ApEH el +k+p ++l +++naG+vflG+ +pe++gdy+aGpnhvLPT+gtAr lcl|NCBI__GCF_000021925.1:WP_015943471.1 305 ILVKDLAEGMNLVNQIAPEHFELVIKEPYSWLGRVRNAGAVFLGRFSPEPVGDYFAGPNHVLPTGGTAR 373 ********************************************************************* PP TIGR00069 344 fasglsvedFlkrisvqelskealeelaeaveklaeaEgLeaHaeavevR 393 f+s+l+v++F+k++sv+++s++al++ ++++++la+ EgLeaHa+ave+R lcl|NCBI__GCF_000021925.1:WP_015943471.1 374 FYSPLNVDTFMKKVSVISYSEKALQRDGKHIAHLARKEGLEAHARAVEAR 423 ************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (393 nodes) Target sequences: 1 (426 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.57 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory