Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate WP_015945186.1 DHAF_RS21850 anthranilate synthase component I
Query= curated2:O66849 (494 letters) >NCBI__GCF_000021925.1:WP_015945186.1 Length = 477 Score = 290 bits (743), Expect = 6e-83 Identities = 184/470 (39%), Positives = 267/470 (56%), Gaps = 47/470 (10%) Query: 47 NILLESAEGGEKWGRYSFIITGSSFYLRTRKDIGEIYERGKVNFFETK------DPLSKI 100 N+L S GEK Y+ + + RT GE G + ET+ DPL+ + Sbjct: 23 NLLRFSETLGEKC--YTLLEGNEEEHQRTYYGFGE----GWILSPETREPGLPPDPLAHL 76 Query: 101 KEVVKKFIPYHDERLPRFWGGLVGYFAYDVVKFYEPVEDKNPDPIHTYDIYLVLTDVVVI 160 ++ ++ P G++GY Y+ ++ + P +Y L ++V Sbjct: 77 RDFCRQNFPARSCE-----SGIIGYLDYEWGLLWQKPKATTAKP--SYFFRLCPINLVF- 128 Query: 161 HDNLTGKIKVVVPIFAQNGIEEE--YERAKNLIRDTVKK--------------LKER--- 201 L KV++ IF+++ E Y+ + D + + L+E Sbjct: 129 ---LPSSQKVILEIFSEDDSELSRLYDHWSTHLEDWISQNHCQDHNHCQDHNHLQEATPS 185 Query: 202 GTTFLNVVEKEPDF-----KNWRSNFTKEEFEDIVKKAKEYIAQGDVIQVVLSQRFRKRF 256 G + K P W++NF EF V+K KEYI GD+ Q VLSQRF Sbjct: 186 GIAAPEIPTKHPSDPVTRPNQWQANFQPGEFISRVEKIKEYIHSGDIFQAVLSQRFTLEK 245 Query: 257 KGNPDNIYRVLRFLNPSPYMYYLDFDQLKVIGSSPEILVRLEEGRIETRPIAGTRKRGRT 316 +P + Y+ LR +NPSP+++ L ++ ++GSSPE+L+ +I+TRPIAGTR RG+ Sbjct: 246 TIDPWSAYQKLRIVNPSPWLFCLFGEKETLVGSSPELLLSSIGSQIQTRPIAGTRPRGKD 305 Query: 317 EEEDKRLEEDLLSDEKERAEHLMLVDLARNDIGRVAKTGSVRVENFMRIERYSHVMHIVS 376 ED++LE++LL D KE AEH MLVDL RND+GRV+ GSV V F +ER+SHVMHIVS Sbjct: 306 PLEDRQLEQELLDDAKEMAEHAMLVDLGRNDLGRVSDYGSVSVGKFCSVERFSHVMHIVS 365 Query: 377 DVVGELREGYDALDVLKATFPAGTVSGAPKVRAMQIIEELENERRGIYAGSVGYISFQGN 436 V G L + YD+LD LKA PAGT+SGAPKVRAM+I+++LE RRG Y G++G + G+ Sbjct: 366 SVEGRLAKAYDSLDALKAVLPAGTLSGAPKVRAMEILQDLEPTRRGPYGGALGIYRWNGD 425 Query: 437 MDMAIAIRTAVYRDRDIFVQAGAGIVADSVPEKEWEETVNKAKALMKAIE 486 +D I IRT + RD ++ VQ+GAGIV DS+P++E+EET++KAKAL K +E Sbjct: 426 LDFCITIRTLMIRDDEVSVQSGAGIVFDSIPQREYEETLHKAKALFKVVE 475 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 552 Number of extensions: 29 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 494 Length of database: 477 Length adjustment: 34 Effective length of query: 460 Effective length of database: 443 Effective search space: 203780 Effective search space used: 203780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory