Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_017597122.1 D471_RS0102240 aminotransferase class V-fold PLP-dependent enzyme
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_000341125.1:WP_017597122.1 Length = 390 Score = 242 bits (618), Expect = 1e-68 Identities = 138/357 (38%), Positives = 196/357 (54%), Gaps = 3/357 (0%) Query: 44 YAYDCAGDAAARFSGDQQGMTYSRLQNPTVEMLEQRIALLEGAEACRATASGMAAMTAAL 103 +A+ AA F G Y+R NPTV LE +A LEG A+ SGM A+TA L Sbjct: 33 FAFPDTETMAASFQGAGSPFVYARYGNPTVAALEDAVADLEGGAGAIASGSGMGAITATL 92 Query: 104 LCQLSAGDHLIGGRAAFGSCRWLTDTQLPKFGIETTVVDARDPQQFIDAIRPNTKVFFFE 163 L G H++ +G + L T ++G+E T VDA DP A+RP+T+V E Sbjct: 93 WALLGTGGHVVAQERLYGGTQALLTTLRERWGVEVTQVDAGDPAAVDAALRPDTRVLVLE 152 Query: 164 TPANPTMDVVDLKAVCAIARERGIVTVVDNAFATPALQRPMDFGADVVAYSATKMMDGQG 223 T ANPT V DL A+ A+AR G +VDN FATP L RP++ GAD+V +SATK M G Sbjct: 153 TIANPTGQVADLPALTALARRHGTTVIVDNTFATPLLCRPIEHGADIVVHSATKYMGGHS 212 Query: 224 RVLAGAVCGTEEFINNTLLPFHRNTGPTLSPFNAWVVLKGLETLDLRIQRQSENALKVAR 283 + G + + G + PF AW++ +GL TL +R++R NA ++AR Sbjct: 213 DTIGGVAVFADAGTLTRVRERTNEFGAVMEPFAAWLINRGLSTLGVRMRRHCANAEELAR 272 Query: 284 FLEGR--VPRVNFPGLPSHPQHNLAMSQM-AAAGPIFSIELDGGRTQAHGLLDALGLIDI 340 L+ V RV++ GLP HP H A + G + + EL GG + + L + Sbjct: 273 RLDRHPAVTRVHYAGLPDHPGHATARELLDGGFGGVLAFELAGGLEAGRSFAERVRLAVL 332 Query: 341 SNNIGDSRSLMTHPASTTHSGVAEDQRLLMGVGEGMLRLNVGLEDPEDLIADLDQAL 397 + ++GD R+L+ HPAST+H + + GV EG++RL+ G+ED EDL ADL++AL Sbjct: 333 APSLGDVRTLVMHPASTSHRMLDAEGLARAGVSEGLIRLSAGIEDVEDLWADLERAL 389 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 390 Length adjustment: 31 Effective length of query: 371 Effective length of database: 359 Effective search space: 133189 Effective search space used: 133189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory