Align Glutamate 5-kinase; EC 2.7.2.11; Gamma-glutamyl kinase; GK (uncharacterized)
to candidate WP_017597788.1 D471_RS0105990 glutamate 5-kinase
Query= curated2:Q82C83 (375 letters) >NCBI__GCF_000341125.1:WP_017597788.1 Length = 292 Score = 335 bits (860), Expect = 7e-97 Identities = 180/279 (64%), Positives = 212/279 (75%), Gaps = 2/279 (0%) Query: 3 AARQGVAQARRIVVKVGSSSLTTAAGGLDADRVDALVDVLAKSRSGGEKEIVLVSSGAIA 62 A R+ VA ARR+VVKVGSSSLTT G +D+ R+ LV+VLA R+ G+ E++LVSSGA+A Sbjct: 15 AGRKAVANARRVVVKVGSSSLTTPEGRIDSSRIRDLVEVLAARRALGQ-EVILVSSGAVA 73 Query: 63 AGLAPLGLRRRPKDLARQQAAASVGQGLLVARYTASCARHGIRVGQVLLTSDDTSRRAHH 122 AG+ PLGL RRP+DLA QQAAASVGQGLL+A YTA A HG+ QVLLT +D RR H Sbjct: 74 AGMTPLGLTRRPRDLASQQAAASVGQGLLLASYTAELAGHGLTAAQVLLTVEDMMRRVQH 133 Query: 123 RNASRTLDKLLAMGALPVVNENDTVATDEIRFGDNDRLAALVAHLVRADLLVLLSDVDGV 182 RNA RTL +LL +GA+P+VNENDTVAT EIRFGDNDRLAALVAHL+RAD LVLLSDVD + Sbjct: 134 RNAQRTLRRLLDIGAVPIVNENDTVATHEIRFGDNDRLAALVAHLLRADALVLLSDVDAL 193 Query: 183 YDGDPSKPGTSRVAQVHGPQDLAHVEIGSAGRAGVGTGGMVTKIEAARIAAAAGIPVVLT 242 YDG+PS P TS V V GP DL ++IG AG+ GVGTGGMVTK+E+ARIA AG+ VLT Sbjct: 194 YDGNPSDPSTSVVDLVRGPGDLDGIDIGGAGKRGVGTGGMVTKVESARIATEAGVQTVLT 253 Query: 243 SAVHAADALAGRDTGTYFHPT-GKRSADRLLWLQHASTP 280 SA +A ALAG GT F P G+R + R LWL P Sbjct: 254 SAANARAALAGERVGTLFAPAEGRRPSTRQLWLPPPPPP 292 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 292 Length adjustment: 28 Effective length of query: 347 Effective length of database: 264 Effective search space: 91608 Effective search space used: 91608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_017597788.1 D471_RS0105990 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.28283.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-98 314.5 0.0 5.9e-98 314.3 0.0 1.0 1 lcl|NCBI__GCF_000341125.1:WP_017597788.1 D471_RS0105990 glutamate 5-kinas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000341125.1:WP_017597788.1 D471_RS0105990 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 314.3 0.0 5.9e-98 5.9e-98 1 265 [. 24 286 .. 24 290 .. 0.97 Alignments for each domain: == domain 1 score: 314.3 bits; conditional E-value: 5.9e-98 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQ 69 +r+VvK+GsssLt+++g++++s++++lve +a++++ G+ev++vsSGavaaG++ Lgl++rp++la++Q lcl|NCBI__GCF_000341125.1:WP_017597788.1 24 RRVVVKVGSSSLTTPEGRIDSSRIRDLVEVLAARRALGQEVILVSSGAVAAGMTPLGLTRRPRDLASQQ 92 59******************************************************************* PP TIGR01027 70 alaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvave 138 a+a+VGQg L+++y++ ++ +gl+ aQ+LLt +d+ +r +++Na++tl++ll++g+vpivNENDtva++ lcl|NCBI__GCF_000341125.1:WP_017597788.1 93 AAASVGQGLLLASYTAELAGHGLTAAQVLLTVEDMMRRVQHRNAQRTLRRLLDIGAVPIVNENDTVATH 161 ********************************************************************* PP TIGR01027 139 eikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgss.vG 206 ei+fGDND+L+alva+l+ Ad+Lvll+dvd+Lyd +p ++p +++ v+ + g++g++ vG lcl|NCBI__GCF_000341125.1:WP_017597788.1 162 EIRFGDNDRLAALVAHLLRADALVLLSDVDALYDGNP-SDPSTSVVDLVRGPGDLDGIDIGGAGKRgVG 229 *************************************.**************999998888888877** PP TIGR01027 207 TGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeak.kkklknrkqwi 265 TGGm tK+e+a++A++agv+++++s+++ ++l+++ vgtlf++ ++ ++r+ w+ lcl|NCBI__GCF_000341125.1:WP_017597788.1 230 TGGMVTKVESARIATEAGVQTVLTSAAN---ARAALAGERVGTLFAPAeGRRPSTRQLWL 286 *************************996...8899***********99667799999997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.98 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory