Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_017598182.1 D471_RS0108275 aminotransferase class V-fold PLP-dependent enzyme
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000341125.1:WP_017598182.1 Length = 405 Score = 268 bits (684), Expect = 3e-76 Identities = 165/391 (42%), Positives = 229/391 (58%), Gaps = 19/391 (4%) Query: 19 TLAIHGGQSPDPSTGAVMPPIYATSTY--------AQSSPGEHQGFEYSRTHNPTRFAYE 70 T A++ +P P+ + P++ +TY A G +G+ Y+R +PT A+ Sbjct: 14 TRALNLPSAPVPAERPMRMPVHRATTYEFHTSQEYADVLAGTQEGYSYARIDSPTVDAFA 73 Query: 71 RCVAALEGG-----TRAFAFASGMAATSTV-MELLDAGSHVVAMDDLYGGTFRLFERVRR 124 VAALEG R AFASGMAA STV M L +AG+HVVA +YG T L + R Sbjct: 74 EGVAALEGAGLRTRVRGQAFASGMAAISTVLMALTEAGAHVVAARSIYGNTHSLLGGLLR 133 Query: 125 RTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVV 184 R G+ FVD+TD A +AA+R DT +++ ET +NP + + D+ +A IAR+ G VV Sbjct: 134 RF-GVRTDFVDVTDLDAVRAAVRPDTAVLFTETLSNPTMAVSDLPELARIAREAGATLVV 192 Query: 185 DNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGG 244 D+TFASP++ RPL GAD+VVHSATK++ GHSD GG+AV EL +++ + +G Sbjct: 193 DSTFASPVVCRPLEHGADVVVHSATKFIGGHSDATGGVAVAA--PELIDRIRAARIDLGP 250 Query: 245 VQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKR 304 P +++L RGL+TLPLR+ CE+A A A LE H A+E+V +P LASHPQ LA + Sbjct: 251 CLAPDEAYLLHRGLETLPLRVARQCESAAAFAAALEGHSAVERVDHPSLASHPQTELAAK 310 Query: 305 QMSG--FGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVAR 362 G +V++ +GG +A RF ++ L T+A SLGG +LV H A TH + Sbjct: 311 LFDAGRCGAVVTVHPRGGQEAGMRFADRIRLGTVAASLGGTHTLVGHVASTTHRQMSETE 370 Query: 363 REQLGISDALVRLSVGIEDLGDLRGDLERAL 393 GIS VR S+G+ED DL D AL Sbjct: 371 LADAGISPGAVRFSIGLEDPQDLIDDALAAL 401 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 34 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 405 Length adjustment: 31 Effective length of query: 366 Effective length of database: 374 Effective search space: 136884 Effective search space used: 136884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory