Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_017598314.1 D471_RS0108975 aconitate hydratase AcnA
Query= curated2:Q4FP16 (203 letters) >NCBI__GCF_000341125.1:WP_017598314.1 Length = 904 Score = 43.9 bits (102), Expect = 9e-09 Identities = 24/69 (34%), Positives = 34/69 (49%) Query: 55 IKDFILNQKPHNQSKILIAGKNFGCGSSREHAPWALLDFGITCVISSSYADIFYSNCFKN 114 I D N + +++ GK +G GSSR+ A G+ VI+ SY I SN Sbjct: 763 IYDAAQNYAAQDIPLVVLGGKEYGSGSSRDWAAKGTRLLGVRAVITESYERIHRSNLIGM 822 Query: 115 GILPITLPE 123 G+LP+ PE Sbjct: 823 GVLPLQFPE 831 Lambda K H 0.319 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 904 Length adjustment: 32 Effective length of query: 171 Effective length of database: 872 Effective search space: 149112 Effective search space used: 149112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory