Align aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate WP_017599040.1 D471_RS0113160 aspartate-semialdehyde dehydrogenase
Query= BRENDA::Q8KQ27 (354 letters) >NCBI__GCF_000341125.1:WP_017599040.1 Length = 352 Score = 438 bits (1127), Expect = e-128 Identities = 228/351 (64%), Positives = 271/351 (77%), Gaps = 8/351 (2%) Query: 3 PVLALVGATGAVGTVMIDIINNRETVPWGEIRLIASARSAGKKLTVRGEELTVIELTAEA 62 P LA+VGATGAVGTVM+DI+ RE V WGEIRL+AS RSAGK L VRGE++ V L E Sbjct: 6 PTLAIVGATGAVGTVMLDILTQRENV-WGEIRLVASPRSAGKVLRVRGEDVVVQALAPEV 64 Query: 63 FDGVDVAMFDVPDEISAEWAPVAAARGAVAVDNSGAFRMDDDVPLVVPEVNADKVGERPR 122 FDGVDVAMFDVPDE+S EWAP+AAARGAVAVDNSGAFRMD DVPLVVPEVNAD+V RPR Sbjct: 65 FDGVDVAMFDVPDEVSKEWAPIAAARGAVAVDNSGAFRMDADVPLVVPEVNADQVRNRPR 124 Query: 123 GIIANPNCTTLSMMAALGALHREFELKELVVASYQAVSGAGKEGVDRLYAELEAV-AGKP 181 GII+NPNCTTLSM+ A+GALHR F + +LVV+SYQA SGAG+EG+D L ++ V A + Sbjct: 125 GIISNPNCTTLSMIVAIGALHRAFGVTDLVVSSYQAASGAGQEGIDTLRDQMAKVSADRG 184 Query: 182 VGVSAGDVRKTLEAAGLSISDSPFPAPLAFNVVPSAGSYKGDGWYSEELKVRNESRKILG 241 + AGDVR + G PFPAPLA+NVVP AGS K DGW SEELKVRNESRKILG Sbjct: 185 IAEKAGDVRAAVGELG------PFPAPLAYNVVPWAGSLKEDGWASEELKVRNESRKILG 238 Query: 242 IPDLKVSATCVRVPVVTTHSLAVHATFAREVTVEEAHKVFEAQPTIVLVDDPENGVFPTP 301 +PDL+VSATCVRVPV+TTHSLAVHATF++EVT + A ++ + +V+ DDP G FPTP Sbjct: 239 LPDLRVSATCVRVPVITTHSLAVHATFSQEVTADAARELLGSAEGVVVQDDPAKGEFPTP 298 Query: 302 AEVVGEDPTYVGRVRQALDFPNTLDFLRVRGQPAQGAAAEHLRDAETLAPQ 352 A+VVG DPT+VGR+RQ+LD P +LD +GAA + AE +A + Sbjct: 299 ADVVGTDPTWVGRIRQSLDDPKSLDLFLCGDNLRKGAALNTAQIAEVVAQE 349 Lambda K H 0.316 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 352 Length adjustment: 29 Effective length of query: 325 Effective length of database: 323 Effective search space: 104975 Effective search space used: 104975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_017599040.1 D471_RS0113160 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.10456.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-119 383.1 0.0 6.3e-119 383.0 0.0 1.0 1 lcl|NCBI__GCF_000341125.1:WP_017599040.1 D471_RS0113160 aspartate-semiald Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000341125.1:WP_017599040.1 D471_RS0113160 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 383.0 0.0 6.3e-119 6.3e-119 2 337 .. 8 347 .. 7 349 .. 0.95 Alignments for each domain: == domain 1 score: 383.0 bits; conditional E-value: 6.3e-119 TIGR01296 2 vaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsaG 70 +aivGatGavG ++l++L +r+ +++l+as rsaGk ++++g+++ v+++ e+f+g+d+a+f lcl|NCBI__GCF_000341125.1:WP_017599040.1 8 LAIVGATGAVGTVMLDILTQRENVWGEIRLVASPRSAGKVLRVRGEDVVVQALAPEVFDGVDVAMFDVP 76 79******************************************************************* PP TIGR01296 71 gsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkpl 139 vske+ap aa++g++ +Dn+ afr+d dvPLvvpevna+++++++ +gii+nPnC+t++++v++ +l lcl|NCBI__GCF_000341125.1:WP_017599040.1 77 DEVSKEWAPIAAARGAVAVDNSGAFRMDADVPLVVPEVNADQVRNRP-RGIISNPNCTTLSMIVAIGAL 144 ********************************************998.********************* PP TIGR01296 140 kdeaklkrvvvstYqavsGaGkkgveeLknqtkavl...egkekepeida..lkakkfakqiafnaipl 203 ++++++ +vvs+Yqa sGaG++g++ L++q+ v + +ek + a + f++++a+n++p lcl|NCBI__GCF_000341125.1:WP_017599040.1 145 HRAFGVTDLVVSSYQAASGAGQEGIDTLRDQMAKVSadrGIAEKAGDVRAavGELGPFPAPLAYNVVPW 213 ******************************986555111456666555543356689************ PP TIGR01296 204 idklkedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeap 272 +++lkedG ++eelk+++e+rkilg +dl+vsatcvrvPv+t+hs++v++ f++e++++ ++elL a+ lcl|NCBI__GCF_000341125.1:WP_017599040.1 214 AGSLKEDGWASEELKVRNESRKILGLPDLRVSATCVRVPVITTHSLAVHATFSQEVTADAARELLGSAE 282 ********************************************************************* PP TIGR01296 273 gvvviddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaelli 337 gvvv+ddp + ++ptP+++vg+d ++vgrir+ l++ k+l+lf+ +DnlrkGaaln+ qiae + lcl|NCBI__GCF_000341125.1:WP_017599040.1 283 GVVVQDDPAKGEFPTPADVVGTDPTWVGRIRQSLDDPKSLDLFLCGDNLRKGAALNTAQIAEVVA 347 **************************************************************876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory