Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); quinate/shikimate dehydrogenase [NAD(P)+] (EC 1.1.1.282) (characterized)
to candidate WP_017601880.1 D471_RS0129115 shikimate dehydrogenase
Query= BRENDA::Q88K85 (282 letters) >NCBI__GCF_000341125.1:WP_017601880.1 Length = 296 Score = 268 bits (685), Expect = 1e-76 Identities = 143/279 (51%), Positives = 184/279 (65%), Gaps = 2/279 (0%) Query: 2 SQQAILAGLIGRGIQLSRTPALHEHEGDAQALRYLYRLIDADQLQLDDSALPGLLEAAQH 61 + ++ L GLIG GI S TP++HE E R +YR +D +L L ++ L+ AA+ Sbjct: 13 AHRSYLVGLIGTGIGPSLTPSMHEREAAELHHRLVYRTVDLAELGLAPDSVVDLVRAARQ 72 Query: 62 TGFTGLNITYPFKQAILPLLDELSDEARGIGAVNTVVLKDGKRVGHNTDCLGFAEGLRRG 121 GF GLN+T+P KQ +LP LD L+ +A +GAVNTVV + G+ VGHNTD FA L RG Sbjct: 73 LGFDGLNVTHPCKQLVLPGLDRLTPDAAALGAVNTVVFESGRTVGHNTDWSAFARCLERG 132 Query: 122 LPDVARRQVVQMGAGGAGSAVAHALLGEGVERLVLFEVDATRAQALVDNLNTHF-GAERA 180 LPDV R +VV +GAGGAG+AV HALLG GV + + + RA+ LV+ L+ H GA Sbjct: 133 LPDVPRDRVVVLGAGGAGAAVVHALLGSGVREVTVVDTRVERARELVERLSGHHPGAVCR 192 Query: 181 VLGTD-LATALAEADGLVNTTPVGMAKLPGTPLPVELLHPRLWVAEIIYFPLETELLRAA 239 GTD L L+ ADG+VN TP+GMA+ PGTP+P +LL P LWVA+I+Y PL TELL A Sbjct: 193 AAGTDALEPLLSRADGMVNATPIGMARHPGTPVPADLLRPSLWVADIVYRPLRTELLALA 252 Query: 240 RALGCRTLDGSNMAVFQAVKAFELFSGRQADAARMQAHF 278 GC T+ G MAVFQA +AF LF+G + D RM AHF Sbjct: 253 EDRGCPTVGGGEMAVFQASQAFGLFTGLEPDTERMLAHF 291 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 296 Length adjustment: 26 Effective length of query: 256 Effective length of database: 270 Effective search space: 69120 Effective search space used: 69120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory