Align Tryptophan synthase alpha chain; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_018123673.1 B149_RS0102960 tryptophan synthase subunit alpha
Query= uniprot:M4NLA4 (266 letters) >NCBI__GCF_000375485.1:WP_018123673.1 Length = 254 Score = 157 bits (398), Expect = 2e-43 Identities = 90/239 (37%), Positives = 132/239 (55%), Gaps = 2/239 (0%) Query: 2 SRIDRRFAALKAANRTGLIPFVTAGDPSPEHMVALMHALVDAGADLIELGVPFSDPMADG 61 S + +R A RT LIPF+ AG P + + AL +AGA +IE+G+PFSDP+ADG Sbjct: 3 SILTKRIREANAQGRTALIPFLPAGFPDLDRFWTELEALDNAGASVIEIGMPFSDPVADG 62 Query: 62 PVIQHASERAIAKGVGLADVLGWVAAFRQHDADTPIVLMGYLNPIETHGYARFAGEAVQA 121 P ++ AS ++ GV L +L + R+ + ++LMGYLNP+ +G RFA QA Sbjct: 63 PAVEAASLHSLELGVNLDYILDGLIE-RKGRFNAGLLLMGYLNPVLQYGPKRFAKRCEQA 121 Query: 122 GVDGVLLVDCPLEESAVLQPLRDA-GLQRILLAAPTTEPSRMAQLCGSAEGFLYYVSFAG 180 GV G+++ D P +ES L+ DA G+ I L T P RM GF Y+VS G Sbjct: 122 GVSGLIIADMPADESTELRETLDAHGVSLIPLVGLNTGPERMKLYAECGNGFCYFVSVLG 181 Query: 181 ITGAAHLSTGDIAARVADVRARAKAPVAVGFGIRDAASAKAIAGFADAVVIGSALVDRL 239 TG ++ ++ + +A P+A+GFGI + + G ADA V GSAL++ + Sbjct: 182 TTGQRDELPAEVLQKLQEAKAAFDIPIALGFGIHKPEQLEELQGLADAAVFGSALINHI 240 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 254 Length adjustment: 24 Effective length of query: 242 Effective length of database: 230 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_018123673.1 B149_RS0102960 (tryptophan synthase subunit alpha)
to HMM TIGR00262 (trpA: tryptophan synthase, alpha subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00262.hmm # target sequence database: /tmp/gapView.18772.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00262 [M=256] Accession: TIGR00262 Description: trpA: tryptophan synthase, alpha subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-64 201.7 0.0 5.2e-64 201.6 0.0 1.0 1 lcl|NCBI__GCF_000375485.1:WP_018123673.1 B149_RS0102960 tryptophan syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000375485.1:WP_018123673.1 B149_RS0102960 tryptophan synthase subunit alpha # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 201.6 0.0 5.2e-64 5.2e-64 5 239 .. 13 244 .. 9 254 .] 0.95 Alignments for each domain: == domain 1 score: 201.6 bits; conditional E-value: 5.2e-64 TIGR00262 5 kkkeekafvpFvtagdPdleksleiiktlvkaGadalElGvpfsDPlaDGptiqaaelRAlkagvkvek 73 ++++ +a++pF+ ag Pdl++ ++ l +aGa+++E+G+pfsDP+aDGp++ aa+l l+ gv+++ lcl|NCBI__GCF_000375485.1:WP_018123673.1 13 NAQGRTALIPFLPAGFPDLDRFWTELEALDNAGASVIEIGMPFSDPVADGPAVEAASLHSLELGVNLDY 81 677889*************************************************************** PP TIGR00262 74 alellkkvrekasniPivlltyynlifkkgveeFyakakeagvdgvlvaDlPleeaddlleaakkhgvk 142 +l+ l + + + n+ + l+ y n+++++g F +++++agv+g+++aD+P +e+ +l+e+ hgv+ lcl|NCBI__GCF_000375485.1:WP_018123673.1 82 ILDGLIERKGR-FNAGLLLMGYLNPVLQYGPKRFAKRCEQAGVSGLIIADMPADESTELRETLDAHGVS 149 99876665555.8******************************************************** PP TIGR00262 143 qiflvaPtaeeerlkkiaekseGfvYlvsvaGvtgarerveeevkelikkvkalskkPvlvGFGiskke 211 i lv ++ +er+k ae ++Gf Y vsv+G tg+r+++ +ev + ++++ka ++P+++GFGi k+e lcl|NCBI__GCF_000375485.1:WP_018123673.1 150 LIPLVGLNTGPERMKLYAECGNGFCYFVSVLGTTGQRDELPAEVLQKLQEAKAAFDIPIALGFGIHKPE 218 ********************************************************************* PP TIGR00262 212 qvkelkelgadgvivGsAlvkiieekld 239 q++el+ l ad+++ GsAl++ i+e + lcl|NCBI__GCF_000375485.1:WP_018123673.1 219 QLEELQGL-ADAAVFGSALINHINEG-G 244 ********.888***********997.4 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (254 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.26 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory