Align Indole-3-glycerol phosphate synthase; Short=IGPS; EC 4.1.1.48 (characterized, see rationale)
to candidate WP_018123676.1 B149_RS0102975 indole-3-glycerol-phosphate synthase
Query= uniprot:A0A166NT80_PSEFL (278 letters) >NCBI__GCF_000375485.1:WP_018123676.1 Length = 258 Score = 145 bits (366), Expect = 9e-40 Identities = 93/228 (40%), Positives = 135/228 (59%), Gaps = 11/228 (4%) Query: 42 GFAKALIDQAKTKQP-AVIAEIKKASPSKGVIRENFVPADIAKSYEKGGATCLSVLTDID 100 G + ID +T P AVIAE K SPSKG +RE+ D A+ YE+ GA +SVLT+ + Sbjct: 31 GERPSFIDAIRTHGPGAVIAEFKPKSPSKGQLREHANILDTAELYERHGAAAMSVLTEPE 90 Query: 101 YFQGADAYLQQARAACKLPVIRKDFMIDPYQIVESRALGADCVLLIVSALD-DVKMAELA 159 YF GA YL AR C+LP++RKDF++DP QI ++ + A VLLI + ++ ++ Sbjct: 91 YFGGAPEYLFMARQTCRLPLLRKDFILDPLQIAQTASTPASAVLLIARMFETSAELRDMV 150 Query: 160 AVAKSVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVNLETTLDLLPRIPRDR 219 +AKS GL +VEV D +L+ + + + ++ VNNR+L T L TTLD+ R+ +D+ Sbjct: 151 RLAKSAGLTPVVEVFDEADLKHS-REAEADVIQVNNRDLGT----LTTTLDISRRLVQDK 205 Query: 220 ----LVITESGILNRADVELMEISDVYAFLVGEAFMRAESPGTELQRL 263 L I+ SG+ R VE + A LVG + M AE+PG +L L Sbjct: 206 AEGELWISASGVDTRKQVEEVATMGFDAVLVGTSLMLAEAPGAKLDYL 253 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 258 Length adjustment: 25 Effective length of query: 253 Effective length of database: 233 Effective search space: 58949 Effective search space used: 58949 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory