Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (uncharacterized)
to candidate WP_018123677.1 B149_RS0102980 anthranilate phosphoribosyltransferase
Query= curated2:C6C1D5 (329 letters) >NCBI__GCF_000375485.1:WP_018123677.1 Length = 336 Score = 336 bits (862), Expect = 4e-97 Identities = 170/321 (52%), Positives = 226/321 (70%), Gaps = 4/321 (1%) Query: 9 LTALSSGQDLTTEQADAVFEELFSGEMTNAQAGALLMGLRTKGEKAVEVAAGVRAALREA 68 L L+ G+ LT EQA A+F+ L +G++ AQAGA LMGLR KGE + ++AAGVRA L A Sbjct: 8 LDTLAKGESLTDEQASAMFDRLMNGDLHPAQAGAFLMGLRAKGEDSTDIAAGVRAGLDRA 67 Query: 69 KLIKGINSP----CIDTCGTGGDGTNSFNCSTAVAIYLADMGYLVTKHGNRAVSSSCGSA 124 I G + P IDTCGTGGDG+ SFNCSTA A++LADMG+ V KHGNRA+SSSCGSA Sbjct: 68 LKIPGYDGPNGKPVIDTCGTGGDGSMSFNCSTATALFLADMGHCVAKHGNRALSSSCGSA 127 Query: 125 DVLEDLGVSLGTTVNEARDVLLRDKFVFMFAPNYHPAFGKIAPIRKELGIPTLFNLMGPL 184 D LED+GV + T EA L F F+FAP YHPAF + PIR+ LGI T+FN MGPL Sbjct: 128 DALEDIGVPIENTPEEAAKQLDAANFTFLFAPAYHPAFKHVMPIRQALGIRTVFNFMGPL 187 Query: 185 LNPARPTHQILGVGRPEILRLMAEVLVLTNVEKAYVIHGAGNFDELTPFGVNDAILVENG 244 LNPARP+HQ++GVG PE L++M E L+LT V++A+VI G G FDE+T FG + +G Sbjct: 188 LNPARPSHQLMGVGDPERLQIMGESLLLTGVDRAFVISGTGGFDEVTTFGPARGYFIHDG 247 Query: 245 ELTEVKIDPADYGFAAAKPEDVAVKDRPEALATIRKVLAGTAPQAMLDMVALNLGAAISI 304 + + I+P GF A P+DV V+DR +A+A +R++L G P+AM+DMVA+NL A +++ Sbjct: 248 IMEKTTINPDRMGFKAHSPDDVRVQDRAQAVAVLREILDGNGPRAMMDMVAVNLAACLNL 307 Query: 305 LDGVSLEEGMEKAKAKVAKGV 325 L ++ E + A+ KV +G+ Sbjct: 308 LGEGTMRECADIARDKVNEGL 328 Lambda K H 0.316 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 309 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 336 Length adjustment: 28 Effective length of query: 301 Effective length of database: 308 Effective search space: 92708 Effective search space used: 92708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_018123677.1 B149_RS0102980 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.20591.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-100 321.9 0.0 3.1e-100 321.6 0.0 1.0 1 lcl|NCBI__GCF_000375485.1:WP_018123677.1 B149_RS0102980 anthranilate phos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000375485.1:WP_018123677.1 B149_RS0102980 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 321.6 0.0 3.1e-100 3.1e-100 2 318 .. 9 327 .. 8 330 .. 0.98 Alignments for each domain: == domain 1 score: 321.6 bits; conditional E-value: 3.1e-100 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkveke...e 67 +l+++++L++e+a ++++ +m+g++++aq +A+l+ lr+kge+ +ia+ ++a +++a k++ + lcl|NCBI__GCF_000375485.1:WP_018123677.1 9 DTLAKGESLTDEQASAMFDRLMNGDLHPAQAGAFLMGLRAKGEDSTDIAAGVRAGLDRALKIPGYdgpN 77 678999*******************************************************99764557 PP TIGR01245 68 seelvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvar 136 + ++D++GTGGDg+ ++N STa+al +a +G vaKhGnr+ ss++GsaD Le +gv +e++pe++a+ lcl|NCBI__GCF_000375485.1:WP_018123677.1 78 GKPVIDTCGTGGDGSMSFNCSTATALFLADMGHCVAKHGNRALSSSCGSADALEDIGVPIENTPEEAAK 146 899****************************************************************** PP TIGR01245 137 sleevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlkn 205 +l+ +++FlfAP+yhpa+k+v+p+R+ Lg+rtvfN++GPLlnPar+++q++Gv +++ ++++ e l lcl|NCBI__GCF_000375485.1:WP_018123677.1 147 QLDAANFTFLFAPAYHPAFKHVMPIRQALGIRTVFNFMGPLLNPARPSHQLMGVGDPERLQIMGESLLL 215 ********************************************************************* PP TIGR01245 206 lgvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkev 274 gv+ra+v++g +g DE++++g+++ + ++dg +e++t++p +g+k ++ +++++++ ++ +++l+e+ lcl|NCBI__GCF_000375485.1:WP_018123677.1 216 TGVDRAFVISGTGGFDEVTTFGPARGYFIHDGIMEKTTINPDRMGFKAHSPDDVRVQDRAQAVAVLREI 284 ********************************************************************* PP TIGR01245 275 legkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksg 318 l g++ +a d+v++N aa l + g+ +++e ++ a++++++g lcl|NCBI__GCF_000375485.1:WP_018123677.1 285 LDGNGPRAMMDMVAVNLAACLNLLGEG-TMRECADIARDKVNEG 327 ***********************9987.9*********999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (336 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.78 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory