Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate WP_018123773.1 B149_RS0103465 glutamate 5-kinase
Query= BRENDA::Q6E235 (370 letters) >NCBI__GCF_000375485.1:WP_018123773.1 Length = 384 Score = 242 bits (617), Expect = 1e-68 Identities = 146/365 (40%), Positives = 214/365 (58%), Gaps = 13/365 (3%) Query: 5 RIVVKIGSSSLTNSNGSIDEAKIKEHTEAISLLKENGHEVILITSGAVAAGFSAL----- 59 R++VK+GS+ LT G EA I+ + +S L + G ++IL++SGAVAAG + Sbjct: 16 RVLVKVGSAVLTREEGLNREAMIRLAGQ-LSRLHDRGMDIILVSSGAVAAGRKRMREAHN 74 Query: 60 GYPARPVTIKGKQAAAAVGQTLLMQQYMDHLKRYGLTPAQILLTRNDFSKRERYRNAYAT 119 G + +QAA+AVGQ LM Y + +G T AQIL+TR+ S R R+ NA T Sbjct: 75 GQMPDMDDLPARQAASAVGQGRLMHDYDEAFGWFGKTTAQILITRDGLSDRHRFLNARNT 134 Query: 120 VMELLERGVVPIINENDSTSVEELTFGDNDMLSALVSGLIHADQLMILTDINGLYDANPN 179 + LL GV+PIINEND+ +V+EL FGDND L+A+ GL AD + LT +G++D+NP+ Sbjct: 135 LERLLSWGVIPIINENDTVAVQELEFGDNDTLAAMALGLAGADLFVNLTSADGVFDSNPD 194 Query: 180 ENPDAKRFDYLTDITPELLGYAGSAGSKVGTGGMKSKFLAAQTALSLGVKVFIGTGAGRE 239 NPDAK + DI+ + VG+GGM SK AA A LGV I +G G Sbjct: 195 SNPDAKCLRIIEDISALDFETMCDGKTSVGSGGMYSKLRAAHRAAQLGVATLIVSGKGEF 254 Query: 240 KLKVILDGKGDGTYIGDKELSTVNNTRQWIMFHSPISGEIIIDGGAEQAMIHNGSSLLPA 299 ++ + + GT+I E +TV++ + W+ +H +G + +D GA +A+ G SLLPA Sbjct: 255 SIEQAFEDERHGTFILPVE-NTVSSKKFWLAYHEDPAGTLTVDAGAARALTEGGKSLLPA 313 Query: 300 GVADVCGSFPKGAVVEVRGPGGIIGKGQTHYSSDEILEAKGKRSDQL-----PGAKQVEV 354 G+ V G FP+G +V+V G ++G G ++YSSDE+ GK S ++ P Q E Sbjct: 314 GIKKVDGCFPRGTLVQVVADGDMLGVGLSNYSSDELHSIAGKNSSEIAQTIGPVPFQ-EA 372 Query: 355 IHRND 359 IHR++ Sbjct: 373 IHRDN 377 Lambda K H 0.314 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 384 Length adjustment: 30 Effective length of query: 340 Effective length of database: 354 Effective search space: 120360 Effective search space used: 120360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
Align candidate WP_018123773.1 B149_RS0103465 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.29398.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-121 390.5 0.0 4.5e-121 390.3 0.0 1.0 1 lcl|NCBI__GCF_000375485.1:WP_018123773.1 B149_RS0103465 glutamate 5-kinas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000375485.1:WP_018123773.1 B149_RS0103465 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 390.3 0.0 4.5e-121 4.5e-121 2 362 .. 16 379 .. 15 380 .. 0.97 Alignments for each domain: == domain 1 score: 390.3 bits; conditional E-value: 4.5e-121 TIGR01027 2 riVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglper.....pkkl 65 r+ vK+Gs++Lt+e+g l+r+ + +l+ q+++l++ G ++++vsSGavaaG +++ + +l lcl|NCBI__GCF_000375485.1:WP_018123773.1 16 RVLVKVGSAVLTREEG-LNREAMIRLAGQLSRLHDRGMDIILVSSGAVAAGRKRMREAHNgqmpdMDDL 83 799************9.***********************************99976654111114689 PP TIGR01027 66 aekQalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDt 134 +Qa++aVGQgrLm+ y+++f ++g+++aQiL+tr+ ls+r+r+lNarntle+ll++gv+pi+NENDt lcl|NCBI__GCF_000375485.1:WP_018123773.1 84 PARQAASAVGQGRLMHDYDEAFGWFGKTTAQILITRDGLSDRHRFLNARNTLERLLSWGVIPIINENDT 152 9******************************************************************** PP TIGR01027 135 vaveeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgs 203 vav+e++fGDNDtL+a+ l +Adl v lt++dg++d++p +npdAk + +e+i++ ++ ++ + lcl|NCBI__GCF_000375485.1:WP_018123773.1 153 VAVQELEFGDNDTLAAMALGLAGADLFVNLTSADGVFDSNPDSNPDAKCLRIIEDISALDFETMCDGKT 221 ******************************************************************999 PP TIGR01027 204 svGTGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqwilaaseak 272 svG GGm +Kl aa+ A+++gv ++i+sg+ + +i ++ ed+ gt++ + +++++++k+w++++++++ lcl|NCBI__GCF_000375485.1:WP_018123773.1 222 SVGSGGMYSKLRAAHRAAQLGVATLIVSGKGEFSIEQAFEDERHGTFILPVENTVSSKKFWLAYHEDPA 290 ********************************************************************* PP TIGR01027 273 GkiivdegaeeallekgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglkse 341 G+++vd+ga++al+e gksLlpag+ +v g F rg v+++a+ g ++g gl+nyss+el++i+g++s+ lcl|NCBI__GCF_000375485.1:WP_018123773.1 291 GTLTVDAGAARALTEGGKSLLPAGIKKVDGCFPRGTLVQVVAD-GDMLGVGLSNYSSDELHSIAGKNSS 358 ****************************************987.************************* PP TIGR01027 342 eiedvLgyekkeevvhrdnlv 362 ei++ +g +e++hrdnl+ lcl|NCBI__GCF_000375485.1:WP_018123773.1 359 EIAQTIGPVPFQEAIHRDNLL 379 *******************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.80 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory