Align 3-isopropylmalate dehydratase large subunit 2; EC 4.2.1.33; Alpha-IPM isomerase 2; IPMI 2; Isopropylmalate isomerase 2 (uncharacterized)
to candidate WP_018124551.1 B149_RS0107400 aconitate hydratase
Query= curated2:O28084 (416 letters) >NCBI__GCF_000375485.1:WP_018124551.1 Length = 640 Score = 290 bits (742), Expect = 9e-83 Identities = 160/413 (38%), Positives = 237/413 (57%), Gaps = 2/413 (0%) Query: 1 MGKTIAEKILSEKSKSDAYA-GDIVVAEIDQIALQDGTAPLAIRQLMELGTEVRAADRTH 59 MGK I KI+ KS + G + EIDQ QD T +A Q +G + + + Sbjct: 1 MGKNITRKIIERHLKSGSMEPGAEIGLEIDQTLTQDATGTMAYLQFEAIGLDRVKTELSV 60 Query: 60 FFVDHAAPSPRRELSNDQKFIYEFAKKVGADFNPPGEGIIHQIMVERYVKPGDLAVGADS 119 +VDH +D +++ A++ G F+PPG GI HQ+ +E + +PG +G+DS Sbjct: 61 SYVDHNTLQMGFRNPDDHRYLRTVAQRYGVIFSPPGTGICHQLHLENFARPGRTLIGSDS 120 Query: 120 HTCTYGGIGAFSTGMGSTDVAVAIALGKNWFRVPESFRVQLDGSLPKGVFAKDVILKLIG 179 HT T GGIG+ + G G VA+A+A +P+ +V L G L AKDVIL L+G Sbjct: 121 HTPTAGGIGSLAMGAGGLSVALAMAGEPYAISMPKVVKVNLTGKLTGWAAAKDVILHLLG 180 Query: 180 DLGVDGATYKALEFHGECAENMTVEERLTIANMAVECGAKAGIFESDENTRKFLAELGRE 239 L V G K E+ G E+++V ER I NM E GA IF SDE TR FL+++GRE Sbjct: 181 KLTVKGGVGKVFEYAGPGVESLSVPERACITNMGAELGATTSIFPSDERTRDFLSKMGRE 240 Query: 240 GDFREVKADEDAEYEKEIYMDVSSLVPVVSKPHNVDNVAEISEVEGTEVNQVYIGTCTNG 299 D+ E+ D DAEY+K I +D+S+L P+V++PH D V + E+ G +++Q IG+CTN Sbjct: 241 DDWEELLPDADAEYDKVIDIDLSALEPLVAQPHMPDLVVPVRELAGLKIDQCAIGSCTNS 300 Query: 300 RLSDLEVAARILKGRKVKEGVRLIVVPASRRVYLQALDKGLIRVFVEAGGMVLNPGCGPC 359 SDL+ A +L G+++ +++ P S++V + LI ++AG +L CGPC Sbjct: 301 SYSDLKTTALVLDGKRIPASTDVLISPGSKQVVKMLAAENLIEPMLDAGARMLECTCGPC 360 Query: 360 VGIHQGILADGEVCISTQNRNFKGRMGNPNAEIFLASPATAAASAVKGYIADP 412 +G+ ++ G V + T NRNF+GR G +A+I+LAS TAA A++G DP Sbjct: 361 IGMGGSPVSAG-VSVRTFNRNFEGRSGTQDAQIYLASAETAARLALEGQFTDP 412 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 634 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 640 Length adjustment: 35 Effective length of query: 381 Effective length of database: 605 Effective search space: 230505 Effective search space used: 230505 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory