Align 3-isopropylmalate dehydratase small subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate WP_018124551.1 B149_RS0107400 aconitate hydratase
Query= curated2:Q9WYC8 (166 letters) >NCBI__GCF_000375485.1:WP_018124551.1 Length = 640 Score = 86.3 bits (212), Expect = 9e-22 Identities = 58/168 (34%), Positives = 90/168 (53%), Gaps = 13/168 (7%) Query: 8 KFGDNISTDHIAPG--RYFHLRNNLEELAKHVLEDAMEDFAKKVQKGD--IIVAGKNFGL 63 K GDNI+TDHI P + LR+N+ +++H+ E+F +++ D +++ G+N+G Sbjct: 473 KVGDNITTDHILPAGPQITALRSNIPAISEHIFGRVDEEFVGRIRGMDQGVVLGGENYGQ 532 Query: 64 GSSREHAARIIKIAGVSCIVAKSFARIFYRNAINVG---LPVIELKEVDEINQGDEL--- 117 GSSREHAA + GV +V KS ARI N +N G L ++ ++ D + QGD L Sbjct: 533 GSSREHAALAPRHLGVRAVVVKSLARIHRANLVNFGILPLLLVNPEDYDAVAQGDGLTIP 592 Query: 118 --EIDLENGVLKNLTTGKEYRFT-PIPKFLLEILKEDGIVNYLKKHGS 162 EI V +GK T + LEI+K G++N ++ S Sbjct: 593 ASEITPGGTVTMRTGSGKSVEVTNDLTANELEIIKSGGLLNAVRSRQS 640 Lambda K H 0.321 0.141 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 166 Length of database: 640 Length adjustment: 27 Effective length of query: 139 Effective length of database: 613 Effective search space: 85207 Effective search space used: 85207 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory