Align Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized)
to candidate WP_018124914.1 B149_RS16860 hypothetical protein
Query= curated2:Q8TYM1 (509 letters) >NCBI__GCF_000375485.1:WP_018124914.1 Length = 359 Score = 197 bits (500), Expect = 7e-55 Identities = 126/340 (37%), Positives = 186/340 (54%), Gaps = 7/340 (2%) Query: 16 IFDTTLRDGEQTPGVALTPEEKLRIARKLDEIGVDTIEAGFAAASEGELKAIRRIAREEL 75 + DTTLR+G Q GV + EE+ +A L +GV+ +E G+A E L+A R + L Sbjct: 2 LIDTTLREGAQMFGVRMGLEERQTVAMGLSCMGVEEMEVGWAGLEE--LEAFCRWSGRRL 59 Query: 76 DAEVCSM-ARMVKGDVDAAVEAEADAVHIVVPTSEVHVKKKLRMDREEVLERAREVVEYA 134 S+ +R + D+ A A ++I VP S+ H +K+L + R ++ R V+ A Sbjct: 60 GKSAISVWSRCRESDIIEAARIGAGRINIGVPASDEHRRKRLDITRRALIARMETVIALA 119 Query: 135 RDHGLTVEISTEDGTRTELEYLYEVFDACLEAGAERLGYNDTVGVMAPEGMFLAVKKLRE 194 R +G+ V + ED +R + ++L ++ AGA R+ +DTVG+ P + AV +LRE Sbjct: 120 RSYGMEVSVGLEDASRADAKWLGKLALKAENAGAFRVRLSDTVGIWTPTKVMKAVSELRE 179 Query: 195 RVGEDVILSVHCHDDFGMATANTVAAVRAGARQVHVTVNGIGERAGNAALEEVVVVLEEL 254 R+ D+ +VHCHDDFGM TAN +AA+ AGA ++ GIGER+G AA EE+ L EL Sbjct: 180 RLVIDI--AVHCHDDFGMGTANAMAALDAGADWADGSLLGIGERSGLAATEELTGYL-EL 236 Query: 255 YGVDTGIRTERLTELSKLVERLTGVRVPPNKAVVGENAFTHESGIHADGILKDESTYEPI 314 + R E L + RL + VP NKAVVG + F ESG+H G+ +D + +EP Sbjct: 237 IDMSGNYRMEGAAPLCARIARLADLAVPRNKAVVGNDIFACESGVHLHGMARDPNLFEPY 296 Query: 315 PPEKVGHERRFVLGKHVGTSVIRKKLKQMGVDVDDEQLLE 354 PE V RR G S+++ L D + LLE Sbjct: 297 SPESVRGARRLGFSAKSGRSLLKTVLGNK-TSADADSLLE 335 Lambda K H 0.315 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 359 Length adjustment: 32 Effective length of query: 477 Effective length of database: 327 Effective search space: 155979 Effective search space used: 155979 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory