Align acetylornithine transaminase (EC 2.6.1.11); 4-aminobutyrate-2-oxoglutarate transaminase (EC 2.6.1.19) (characterized)
to candidate WP_018125191.1 B149_RS0110790 aspartate aminotransferase family protein
Query= BRENDA::B1XNF8 (418 letters) >NCBI__GCF_000375485.1:WP_018125191.1 Length = 399 Score = 306 bits (783), Expect = 9e-88 Identities = 162/395 (41%), Positives = 247/395 (62%), Gaps = 14/395 (3%) Query: 24 VMHTYGRFPVAIAKGEGCRLWDTEGKSYLDFVAGIATCTLGHAHPALIQAVSAQIQKLHH 83 +M TYGR+P+A++K +GC L+D EG YLD ++GIA C+LGH+ P L ++ Q +K+ H Sbjct: 16 MMQTYGRYPLAVSKAQGCTLFDLEGNEYLDLLSGIAVCSLGHSRPELADVMAEQARKMVH 75 Query: 84 ISNLYYIPEQGALAQWIVEHSCADKVFFCNSGAEANEAAIKLVRKYAHTVSDFLEQPVIL 143 +SNL+Y EQ LA+ +++ AD+VFF NSGAEANE AIKL R+Y V + ++ Sbjct: 76 VSNLFYQNEQLDLAEKLLDTCDADRVFFSNSGAEANEGAIKLARRYMRKVRQ-TDAAEVI 134 Query: 144 SAKSSFHGRTLATITATGQP-KYQKHFDPLPDGFAYVPYNDIRALEEAITDIDEGNRRVA 202 + + SFHGRTL+T+TATGQ + FDPLP GF VP+ ++ AL++A++ A Sbjct: 135 TLQQSFHGRTLSTLTATGQEGPIKDGFDPLPPGFTTVPFANVEALKDALSP------NTA 188 Query: 203 AIMLEALQGEGGVRPGDVEYFKAVRRICDENGILLVLDEVQVGVGRTGKYWGYENLGIEP 262 A+M+E +QGEGGVRP EY +A++ + E G L+++DEVQ G+ RTG++W +++ G+ P Sbjct: 189 AVMIEMVQGEGGVRPLPHEYVEALKELRKEYGFLIIVDEVQTGMCRTGRFWAHQHYGLVP 248 Query: 263 DIFTSAKGLAGGIPIGAMMCKDSCAV-FNPGEHASTFGGNPFSCAAALAVVETLEQENLL 321 DIFTSAK LA G+P+GA++ + A F PG HA+TFGG A A V++ + + L Sbjct: 249 DIFTSAKALANGLPMGAVLATEEVAKGFEPGSHATTFGGGALVSAVAAKVIDIMRHDKLD 308 Query: 322 ENVNARGEQLRAGLKTLAEKYP-YFSDVRGWGLINGMEIKADLELTSIEVVKAAMEKGLL 380 + E + LA+++P RG GL+ G+E L +V KA +++ ++ Sbjct: 309 QRAAQLEEWFKLEATKLAQRHPDKVKGARGLGLLLGIE----LTFEGKDVWKALLDRRIV 364 Query: 381 LAPAGPKVLRFVPPLIVSAAEINEAIALLDQTLAA 415 +LR VPPLI+ ++ + L++ L A Sbjct: 365 CNLTQGNILRLVPPLIIEKEDLKRFLKELEEVLEA 399 Lambda K H 0.319 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 399 Length adjustment: 31 Effective length of query: 387 Effective length of database: 368 Effective search space: 142416 Effective search space used: 142416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory