Align serine O-acetyltransferase; EC 2.3.1.30 (characterized, see rationale)
to candidate WP_018125287.1 B149_RS0111395 serine acetyltransferase
Query= uniprot:Q72EB6_DESVH (323 letters) >NCBI__GCF_000375485.1:WP_018125287.1 Length = 304 Score = 350 bits (897), Expect = e-101 Identities = 173/296 (58%), Positives = 221/296 (74%), Gaps = 4/296 (1%) Query: 18 LERIVESLCTPESYEAVYHQSLHG-SPMPSLEALTELMARLRAALFPGYFGASNIVLESM 76 L+++VE LC + A+ + G +PMPS++ L+E++ LR+ LFPGY+G S I ++ Sbjct: 7 LDKVVERLCG--NGHAIASRRFRGDAPMPSVDTLSEIVEDLRSVLFPGYYGPSEITPATL 64 Query: 77 RYHLAANLDSIYRILAEQVRRGGCFACADYATD-CQNCESHSQETAMEFMRALPRIRQLL 135 Y + + LD + R LA+Q+ RG CF C + C +CE + TA +F+ ALP IR++L Sbjct: 65 PYSVGSTLDRVERNLADQINRGYCFVCDREGRERCADCEQRALTTARKFIMALPDIREML 124 Query: 136 ATDVKAAYEGDPAAKSPGETIFCYPSIYAMIHHRIAHELYRLDVPVIPRIISEMAHSRTG 195 DV+AAY+GDPAAK+ GETIFCYPSI A+ +HRIAHEL+RLDV +IPRIISEMAHS TG Sbjct: 125 LGDVEAAYDGDPAAKTHGETIFCYPSIRALTNHRIAHELHRLDVDIIPRIISEMAHSDTG 184 Query: 196 IDIHPGATVGEEFFIDHGTGVVIGETCIIGRGCRLYQGVTLGALSFPKDGGGALIKGIPR 255 IDIHPGAT+G+ FFIDHGTG VIGETC+IG R+YQGVTLGA SFPK G LIKG+PR Sbjct: 185 IDIHPGATIGKRFFIDHGTGTVIGETCVIGENVRIYQGVTLGAKSFPKGEGDQLIKGLPR 244 Query: 256 HPILQDGVTVYAGATILGRVTIGAGAIVGGNVWVTHDVAPGAKVVQQKSSPPAAED 311 HPI++D VYAGATILGRVTIG GA++GGNVW+T DV GA VVQ ++ A E+ Sbjct: 245 HPIVEDDAIVYAGATILGRVTIGRGAVIGGNVWITRDVPAGASVVQSRAMRYAFEN 300 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 304 Length adjustment: 27 Effective length of query: 296 Effective length of database: 277 Effective search space: 81992 Effective search space used: 81992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory