Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_018125376.1 B149_RS0111840 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_000375485.1:WP_018125376.1 Length = 308 Score = 172 bits (435), Expect = 1e-47 Identities = 104/300 (34%), Positives = 166/300 (55%), Gaps = 12/300 (4%) Query: 9 YFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKSAK 68 +F+ + VP+E A + V THALHYGT F G+R + G+ +FRL H RL SAK Sbjct: 9 WFDGELVPWEQANVHVLTHALHYGTGVFEGIRAYECTD--GSSEVFRLKEHMVRLLDSAK 66 Query: 69 FLHYDI--SAEKIKEVIVDFVKKNQPDKSFYIRPLVY--SSGLGIAPRLHNLEKDFLVY- 123 L + S E++ + + +K N+ K Y+RPLV+ +G+ P + + + Sbjct: 67 ILGIKVPYSLEELVQATDETLKANKL-KGAYVRPLVFVGDGAMGVHPGNNPIRVCIATWP 125 Query: 124 -GLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAILM 182 G +GD G+ R SS+ R + K Y+ S LAKTEAV G+DEAIL+ Sbjct: 126 WGAYLGDEALEKGIRVRCSSYTRHHVNVMMTKAKACGNYVNSVLAKTEAVADGYDEAILL 185 Query: 183 NSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDKSE 242 ++ G V E +G N+FMV++ + TP Q +L G+TRDS++ +A+DLG + I + Sbjct: 186 DTTGHVAEGSGENIFMVKDEVLYTPHLSQ-VLGGLTRDSVIQLASDLGYEVREMAIGRDM 244 Query: 243 LMIADEVFLSGTAAKITPVKRIENFTLGGDR--PITEKLRSVLTAVTENREPKYQDWVFK 300 L ADEVF +GTAA++TP++ I+ +G + +T+ L++ + + Y+ W+ + Sbjct: 245 LYTADEVFFTGTAAELTPIREIDRRQVGEGKAGDVTKALQTEFFKILKGENEDYEHWLHR 304 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 308 Length adjustment: 27 Effective length of query: 278 Effective length of database: 281 Effective search space: 78118 Effective search space used: 78118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory