Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_018125376.1 B149_RS0111840 branched-chain amino acid transaminase
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >NCBI__GCF_000375485.1:WP_018125376.1 Length = 308 Score = 357 bits (916), Expect = e-103 Identities = 169/302 (55%), Positives = 217/302 (71%) Query: 3 MADRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKR 62 M + IW DG+L+ W A +HVLTH LHYG GVFEG+RAY+ DG + +FRL+EH R Sbjct: 1 MVQQSEYIWFDGELVPWEQANVHVLTHALHYGTGVFEGIRAYECTDGSSEVFRLKEHMVR 60 Query: 63 LLNSAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVA 122 LL+SAKI + VP+ E L A E ++ NKL+ Y+RP+++VG +GV N I V Sbjct: 61 LLDSAKILGIKVPYSLEELVQATDETLKANKLKGAYVRPLVFVGDGAMGVHPGNNPIRVC 120 Query: 123 IAAWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYD 182 IA WPWGAYLG++ + KGIRV+ SS+TRHHVNV M +AKA G YVNS+LA EA+ADGYD Sbjct: 121 IATWPWGAYLGDEALEKGIRVRCSSYTRHHVNVMMTKAKACGNYVNSVLAKTEAVADGYD 180 Query: 183 EALLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRI 242 EA+LLD G+V+EGSGEN F+V + LYTP LS L G+TRD+VI LA D G +V E I Sbjct: 181 EAILLDTTGHVAEGSGENIFMVKDEVLYTPHLSQVLGGLTRDSVIQLASDLGYEVREMAI 240 Query: 243 TRDEVYTCDEAFFTGTAAEVTPIRELDNRTIGSGARGPITEKLQSGFFDIVNGKSDKYAN 302 RD +YT DE FFTGTAAE+TPIRE+D R +G G G +T+ LQ+ FF I+ G+++ Y + Sbjct: 241 GRDMLYTADEVFFTGTAAELTPIREIDRRQVGEGKAGDVTKALQTEFFKILKGENEDYEH 300 Query: 303 WL 304 WL Sbjct: 301 WL 302 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 308 Length adjustment: 27 Effective length of query: 280 Effective length of database: 281 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_018125376.1 B149_RS0111840 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.5312.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-138 444.5 0.0 9.7e-138 444.3 0.0 1.0 1 lcl|NCBI__GCF_000375485.1:WP_018125376.1 B149_RS0111840 branched-chain am Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000375485.1:WP_018125376.1 B149_RS0111840 branched-chain amino acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.3 0.0 9.7e-138 9.7e-138 1 296 [. 9 303 .. 9 305 .. 0.98 Alignments for each domain: == domain 1 score: 444.3 bits; conditional E-value: 9.7e-138 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdk.glaifrlkehveRlydsakilrleipyske 68 w+dGelv++e+a+vhvlthalhYGtgvfeGiRaYe + + +frlkeh+ Rl+dsakil +++pys e lcl|NCBI__GCF_000375485.1:WP_018125376.1 9 WFDGELVPWEQANVHVLTHALHYGTGVFEGIRAYECTDgSSEVFRLKEHMVRLLDSAKILGIKVPYSLE 77 9**********************************8772578*************************** PP TIGR01122 69 elvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvss 137 elv++t e+l++n+lk aY+Rplv+vG++ +g++p + +++v+ia+w+wgaylg+ealekGi+v+ ss lcl|NCBI__GCF_000375485.1:WP_018125376.1 78 ELVQATDETLKANKLKGAYVRPLVFVGDGAMGVHP-GNNPIRVCIATWPWGAYLGDEALEKGIRVRCSS 145 ***********************************.888****************************** PP TIGR01122 138 frraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvse 206 ++r++vn+++tkaka gnY+ns+lak+ea++ GydeailLd+ G+vaeGsGenif+vkd vl+tP + + lcl|NCBI__GCF_000375485.1:WP_018125376.1 146 YTRHHVNVMMTKAKACGNYVNSVLAKTEAVADGYDEAILLDTTGHVAEGSGENIFMVKDEVLYTPHL-S 213 *******************************************************************.6 PP TIGR01122 207 siLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkk 275 ++L g+trd+vi+la++lg+ev+e i+r++lytaDevf+tGtaae+tPire+D r++gegk+G+vtk lcl|NCBI__GCF_000375485.1:WP_018125376.1 214 QVLGGLTRDSVIQLASDLGYEVREMAIGRDMLYTADEVFFTGTAAELTPIREIDRRQVGEGKAGDVTKA 282 7******************************************************************** PP TIGR01122 276 lqeaffdlvegktekkeewlt 296 lq++ff++++g++e++e+wl+ lcl|NCBI__GCF_000375485.1:WP_018125376.1 283 LQTEFFKILKGENEDYEHWLH 303 *******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (308 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.52 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory