Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_018232567.1 THITHI_RS0108035 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_000378965.1:WP_018232567.1 Length = 442 Score = 474 bits (1221), Expect = e-138 Identities = 239/430 (55%), Positives = 306/430 (71%), Gaps = 2/430 (0%) Query: 5 VNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQI 64 +NW R+A+PYIN+HR RTFV+ GE V+ F ++HD+ +L SLG RLVLVHG+RPQI Sbjct: 12 INWFRNAAPYINAHRGRTFVIAFGGEAVQDTGFARLIHDIAMLQSLGVRLVLVHGARPQI 71 Query: 65 EARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRVA 124 E RL ARG A Y LR+TDA L+ V +A G LR+ IEA+LSM +A +PM GAR+RVA Sbjct: 72 EQRLRARGQAFHYAAGLRITDADALQEVKEAAGCLRVEIEAQLSMGLANTPMSGARIRVA 131 Query: 125 GGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLAC 184 GN V A+P+GV +GVDY HTGEVRRID +GI R L+ +VLLSPLGYSPTGE+FNL+ Sbjct: 132 SGNHVMAKPLGVRDGVDYQHTGEVRRIDAEGIRRHLENGEVVLLSPLGYSPTGEVFNLSA 191 Query: 185 EDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQVPAHLQRLGN--SYQAELLD 242 EDVA AI L+A+KLI E L D + + ++ +Q L R S A L Sbjct: 192 EDVATATAISLKADKLIFLTEEPRLRDGRRRPISQMTAEQARTWLNRRRGPASETARHLT 251 Query: 243 AAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIEL 302 +A ACR V+R H+V DGALL EL+TR G GTL+ E +E+LR A I+DVGG++EL Sbjct: 252 SAIHACRHAVERVHLVERAVDGALLLELYTRDGVGTLITGETYERLRRATIDDVGGILEL 311 Query: 303 IRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPEY 362 I+PLE +G+LVRRSRE LE EI++FS++ER+G+++ C A YP + GELACLA++P+Y Sbjct: 312 IQPLEAEGVLVRRSREQLELEIDRFSVIERDGVVLGCTAFYPFPEESVGELACLAIHPQY 371 Query: 363 RHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNFQ 422 R RGD LL+ +E AR LG+ LFVLTTRTAHWFRERGF+P ++ LP R LYN+Q Sbjct: 372 RTASRGDRLLDFVEAEARTLGIARLFVLTTRTAHWFRERGFEPGDIKALPLRRRELYNYQ 431 Query: 423 RNSQVFEKSL 432 RNS+VF K L Sbjct: 432 RNSKVFIKGL 441 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 442 Length adjustment: 32 Effective length of query: 400 Effective length of database: 410 Effective search space: 164000 Effective search space used: 164000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_018232567.1 THITHI_RS0108035 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.18207.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-189 615.6 0.3 2.7e-189 615.4 0.3 1.0 1 lcl|NCBI__GCF_000378965.1:WP_018232567.1 THITHI_RS0108035 amino-acid N-ac Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000378965.1:WP_018232567.1 THITHI_RS0108035 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 615.4 0.3 2.7e-189 2.7e-189 2 428 .. 12 440 .. 11 441 .. 0.99 Alignments for each domain: == domain 1 score: 615.4 bits; conditional E-value: 2.7e-189 TIGR01890 2 vkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgr 70 ++w+r+aaPyinahr++t+v+++gge+v+d +++l++dia+l+slGvrlvlvhGarpqie+rl +rg+ lcl|NCBI__GCF_000378965.1:WP_018232567.1 12 INWFRNAAPYINAHRGRTFVIAFGGEAVQDTGFARLIHDIAMLQSLGVRLVLVHGARPQIEQRLRARGQ 80 79******************************************************************* PP TIGR01890 71 tthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdy 139 hy Glr+td+ +l+ vkeaaG lr +iea+lsm lantpm+g+r++v+sGn v+a+P+Gv +Gvdy lcl|NCBI__GCF_000378965.1:WP_018232567.1 81 AFHYAAGLRITDADALQEVKEAAGCLRVEIEAQLSMGLANTPMSGARIRVASGNHVMAKPLGVRDGVDY 149 ********************************************************************* PP TIGR01890 140 ehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGild 208 +htGevr+idaegirr+l+++++vllsPlg+s+tGe+fnl++edvat +ai+lkadkli+ltee+ + d lcl|NCBI__GCF_000378965.1:WP_018232567.1 150 QHTGEVRRIDAEGIRRHLENGEVVLLSPLGYSPTGEVFNLSAEDVATATAISLKADKLIFLTEEPRLRD 218 ********************************************************************* PP TIGR01890 209 adGklvaelsaqeveslverleeet..tarllsaavkalrgGvarshlvsyaedGallqelftrdGiGt 275 + + +++a+++++ ++r ++ tar l++a++a+r v+r+hlv+ a dGall+el+trdG+Gt lcl|NCBI__GCF_000378965.1:WP_018232567.1 219 GRRRPISQMTAEQARTWLNRRRGPAseTARHLTSAIHACRHAVERVHLVERAVDGALLLELYTRDGVGT 287 *******************999876669***************************************** PP TIGR01890 276 lvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypyae 344 l++ e++e +r+atiddvggileli+Ple++G+lvrrsre+le ei++fsvie+dG+++gc+a+yp++e lcl|NCBI__GCF_000378965.1:WP_018232567.1 288 LITGETYERLRRATIDDVGGILELIQPLEAEGVLVRRSREQLELEIDRFSVIERDGVVLGCTAFYPFPE 356 ********************************************************************* PP TIGR01890 345 eevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearr 413 e+vgelacla++P++r + rG+rll +e+ ar++G+ rlfvlttrt+hWfrerGf++ ++++lP rr lcl|NCBI__GCF_000378965.1:WP_018232567.1 357 ESVGELACLAIHPQYRTASRGDRLLDFVEAEARTLGIARLFVLTTRTAHWFRERGFEPGDIKALPLRRR 425 ********************************************************************* PP TIGR01890 414 klynyqrrskilvkk 428 +lynyqr+sk+++k lcl|NCBI__GCF_000378965.1:WP_018232567.1 426 ELYNYQRNSKVFIKG 440 ************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (442 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.14 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory