Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_019555867.1 F612_RS0100950 diaminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_000381085.1:WP_019555867.1 Length = 428 Score = 174 bits (441), Expect = 5e-48 Identities = 123/410 (30%), Positives = 200/410 (48%), Gaps = 24/410 (5%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPH 74 P + AE+WD GKRYIDF G G LN GH NP + +A+ + L + A Sbjct: 21 PTIFEKSKMAEIWDVSGKRYIDFFAGAGALNYGHNNPKINDAV---ISYLQNDGIGHALD 77 Query: 75 GPYLALMEQLSQFV-------PVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIAFDG 127 +A + + FV + Y L + +G A E ALK+AR G++ I++F Sbjct: 78 MGTVAKRDFMESFVNNILKPRDLDYKLQ-FVGPTGTGAIEAALKIARKVKGRKQIMSFTN 136 Query: 128 GFHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPS--ADTGVTCEQALKAMDRLFSVE 185 GFHG ++ +L++ G + + G +PG +P+ D T K ++ S Sbjct: 137 GFHGMSMGSLSITGNKYYHDESYG-VPGYTTQVPFHKYLGDKVDTIAYLRKILEDDSS-- 193 Query: 186 LAVEDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAF 245 E AA + E VQ EGG + + LR+ CD+ IL+I+D+IQ G GR+G F+F Sbjct: 194 -GTELPAAIVLETVQAEGGINVAGEEWLKDLRQICDDFDILMIVDDIQVGNGRSGDFFSF 252 Query: 246 PRLGIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQ 305 R GI+PD++ L+KSI G P+ V+ + EL G GT+ GN ++ A+ +L Sbjct: 253 ERAGIKPDIITLSKSIGAGHPMALVLLKPEL-DIWTAGEHSGTFRGNNLAFVASTVALDT 311 Query: 306 MTDENLATWGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQLA 365 ++ + + + +V + + S I G+G + G EF + P+ + Sbjct: 312 YWSDDSFSKEVKIKAKLVEQRMQKLVSRFPEIINETRGLGMIWGAEFKD------PSITS 365 Query: 366 KVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 + A GL++ +G +I+ L PL + E++ EG DILE + ++ Sbjct: 366 AICSQAFEDGLVIETAGAESDLIKFLGPLVMTEELINEGFDILENAIVKV 415 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 428 Length adjustment: 32 Effective length of query: 384 Effective length of database: 396 Effective search space: 152064 Effective search space used: 152064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory