Align phosphoribosylanthranilate isomerase; EC 5.3.1.24 (characterized)
to candidate WP_019555907.1 F612_RS0101155 phosphoribosylanthranilate isomerase
Query= CharProtDB::CH_008324 (213 letters) >NCBI__GCF_000381085.1:WP_019555907.1 Length = 212 Score = 192 bits (488), Expect = 4e-54 Identities = 101/207 (48%), Positives = 143/207 (69%), Gaps = 7/207 (3%) Query: 2 RTRAKICGITRSQDVQAAVSAGADAIGLVFFPPSPRHVSIAQAQALLQHIPAYVQVVGLF 61 RTR KICG+T +D AV+ GADA+GLVF+ PSPRHV+I QA ++ + IPA+V LF Sbjct: 7 RTRVKICGLTSKEDALLAVNNGADAVGLVFYEPSPRHVNIDQACSIAESIPAFVTKTALF 66 Query: 62 VNATADQIKSVLDCVALDVLQLHGDETPEQCQEIALQCKRRWYKAIQVKPELDVVDEVQR 121 VN A+ +K+VL V +D+LQ HGDE+PE C++ L + KA++++ +D+V +R Sbjct: 67 VNPDAEYVKAVLRSVKIDLLQFHGDESPEFCEQFGL----TYIKAVRMREGIDLVALEKR 122 Query: 122 YQAAGASAVLLDAWHPELKGGTGHQFDWSKFPK-LDIPLILAGGLTPENVVDAIQTTHAF 180 Y +G++ +LLDA+ + GGTG QFDW+ P + +ILAGGL ENV AIQ + Sbjct: 123 Y--SGSAGLLLDAYKKGVPGGTGEQFDWASIPAGIAQKIILAGGLKAENVQRAIQQVAPW 180 Query: 181 AVDVSGGVEAAKGIKDKQLIERFMQGV 207 A+DVSGGVEA+KG+K + I++FMQ V Sbjct: 181 ALDVSGGVEASKGVKSAEKIQKFMQQV 207 Lambda K H 0.321 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 212 Length adjustment: 21 Effective length of query: 192 Effective length of database: 191 Effective search space: 36672 Effective search space used: 36672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory