Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_019555908.1 F612_RS0101160 tryptophan synthase subunit beta
Query= uniprot:P50383 (425 letters) >NCBI__GCF_000381085.1:WP_019555908.1 Length = 401 Score = 131 bits (330), Expect = 3e-35 Identities = 118/375 (31%), Positives = 172/375 (45%), Gaps = 54/375 (14%) Query: 61 IPEEVRDRYLSIGRPTPLFRAKRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAK 120 + E D +GRPTPL+ AKR E L A+IY K E TG+HK+N AI QA AK Sbjct: 48 LKELAEDLQNYVGRPTPLYYAKRWSESLGG-AKIYLKREDLNHTGAHKVNNAIGQALLAK 106 Query: 121 EEGIEHVVTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYAS 180 G ++ ETGAGQ G A A A+ ++ ++M ++ M++ GA V A Sbjct: 107 RLGKTRIIAETGAGQHGVASATVAARLGLECVVYMGADDIVRQAPNVMRMKMLGATVIA- 165 Query: 181 PTNLTEYGRKILETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVLD------VVLLH 232 E G + L+ A++EA+ + N + Y++G+V +V Sbjct: 166 ----VESGSRTLKD----------ALNEAMRDWVTNVDDTFYIIGTVAGPHPYPAMVRDF 211 Query: 233 QSVIGQETITQ-LDLLGEDADILIGCVGGGSNFGGFTYPFIGNKKGK------------- 278 Q++IG+ET Q L G+ D+LI CVGGGSN G Y F+G+ K Sbjct: 212 QAIIGRETKQQSLTQEGKLPDVLIACVGGGSNAIGLFYEFLGDDSVKMVGVEPGGLGLET 271 Query: 279 -RYIAVSSAEIPKFSKGEYKYDFPDSAGLLPLVKMITLGKDYVPPPIYAGGLRYHGVAPT 337 ++ A P G Y D G + LG + + GL Y GV P Sbjct: 272 GKHAAPLCKGSPGVLHGNRTYLMQDENGQI-------LGTHSI-----SAGLDYPGVGPE 319 Query: 338 LSLLTKEGIVEWREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERK 397 + L VE+ ++ E + + + +GI+PA ES+HAI A K+ + Sbjct: 320 HAWLKDIKRVEYVSIDDEEALQGFRDLTKYEGIIPALESSHAIAYATKLAPTLSKD---Q 376 Query: 398 VIVFNLSGHGLLDLS 412 VIV NLSG G D++ Sbjct: 377 VIVVNLSGRGDKDMN 391 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 401 Length adjustment: 31 Effective length of query: 394 Effective length of database: 370 Effective search space: 145780 Effective search space used: 145780 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_019555908.1 F612_RS0101160 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.26209.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-199 646.9 0.1 6.6e-199 646.7 0.1 1.0 1 lcl|NCBI__GCF_000381085.1:WP_019555908.1 F612_RS0101160 tryptophan syntha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000381085.1:WP_019555908.1 F612_RS0101160 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 646.7 0.1 6.6e-199 6.6e-199 1 383 [. 13 395 .. 13 397 .. 1.00 Alignments for each domain: == domain 1 score: 646.7 bits; conditional E-value: 6.6e-199 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggakiy 69 g+fg +GG++ pe+l++ale+l ++y ++k+d++f kel e l++y+grptpl++ak+ s++lggakiy lcl|NCBI__GCF_000381085.1:WP_019555908.1 13 GHFGPYGGTFAPETLMAALEQLSQEYASVKNDPDFLKELAEDLQNYVGRPTPLYYAKRWSESLGGAKIY 81 68******************************************************************* PP TIGR00263 70 lkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedverqk 138 lkredl+htGahk+nna+gqallakrlGk+riiaetGaGqhGva+at+aa+lglec+vymGa+d+ rq+ lcl|NCBI__GCF_000381085.1:WP_019555908.1 82 LKREDLNHTGAHKVNNAIGQALLAKRLGKTRIIAETGAGQHGVASATVAARLGLECVVYMGADDIVRQA 150 ********************************************************************* PP TIGR00263 139 lnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvigeev 207 +nv+rm++lga+v++v+sGs+tlkda+nea+rdWvt+v+dt+y++G+++GphP+P++vr+fq++ig+e+ lcl|NCBI__GCF_000381085.1:WP_019555908.1 151 PNVMRMKMLGATVIAVESGSRTLKDALNEAMRDWVTNVDDTFYIIGTVAGPHPYPAMVRDFQAIIGRET 219 ********************************************************************* PP TIGR00263 208 keqilekegrlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGkeGvlhG 276 k+q l +eg+lPd++iacvGGGsnaiG+f++f+ d++v+++gve+gG+G++t khaa l kG++GvlhG lcl|NCBI__GCF_000381085.1:WP_019555908.1 220 KQQSLTQEGKLPDVLIACVGGGSNAIGLFYEFLGDDSVKMVGVEPGGLGLETGKHAAPLCKGSPGVLHG 288 ********************************************************************* PP TIGR00263 277 aktkllqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeGiipale 345 ++t+l+qde+Gqi +hs+saGldypgvgPeha+l++++r+ey++i+deeal++++ l+k eGiipale lcl|NCBI__GCF_000381085.1:WP_019555908.1 289 NRTYLMQDENGQILGTHSISAGLDYPGVGPEHAWLKDIKRVEYVSIDDEEALQGFRDLTKYEGIIPALE 357 ********************************************************************* PP TIGR00263 346 sshalaaleklapklkkdeivvvnlsGrGdkdletvak 383 ssha+a+++klap+l+kd+++vvnlsGrGdkd++t+a+ lcl|NCBI__GCF_000381085.1:WP_019555908.1 358 SSHAIAYATKLAPTLSKDQVIVVNLSGRGDKDMNTIAQ 395 ************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory