Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_019557121.1 F612_RS0107385 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >NCBI__GCF_000381085.1:WP_019557121.1 Length = 436 Score = 124 bits (312), Expect = 4e-33 Identities = 96/310 (30%), Positives = 151/310 (48%), Gaps = 26/310 (8%) Query: 18 VPNYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHV 77 +PN P + + GS + G E+ID + G+ HP + A+ Q + H+ Sbjct: 27 IPNPNPVIGV-TKTQGSILTLADGCEVIDGMSSWWAAIHGYNHPFIQQAMHNQIEIMPHI 85 Query: 78 S-NVFTNEPALRLAHKLVDAT--FAERVFFCNSGAEANEAAFKLARRVAHDRFGTEKYEI 134 T++PA+ LA +L+ T +VFF +SG+ A E A K+A + + EK + Sbjct: 86 MFGGLTHQPAIELAKRLIHLTPPGLVKVFFSDSGSVAMEVAIKMALQFWISKNKPEKNRL 145 Query: 135 VAALNSFHGRTLFTVNV-----GGQSKYSDGFG-------PKITGITHVPYNDLAALKAA 182 + N +HG T T+ G ++D P++ +D+ A +A Sbjct: 146 LTVRNGYHGDTFATMATSDPDNGMHHIFNDNLAHHIFAPAPEMGFSIESDNSDIQAFEAL 205 Query: 183 VS---DKTCAVVLEPI-QGEGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKL 238 + VV+EPI QG GG+ YL R LC ++ LL+ DE+ TG GR+GKL Sbjct: 206 LEAHHTSIATVVIEPIAQGAGGMRFYRPDYLNRVRMLCTQYDVLLIIDEIATGFGRTGKL 265 Query: 239 FAYQHYGVTPDILTSAKSLGGGF-PIAAMLTTEDLAKHLVVGT-----HGTTYGGNPLAC 292 FA + + PDI+ K+L GG+ +AA L ++ ++ + G HG T+ NPLAC Sbjct: 266 FACEWADIAPDIMCVGKALTGGYMTLAATLCSQTISDTISNGNPGLLMHGPTFMANPLAC 325 Query: 293 AVAEAVIDVI 302 A A A ID++ Sbjct: 326 ATAIASIDLL 335 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 436 Length adjustment: 32 Effective length of query: 374 Effective length of database: 404 Effective search space: 151096 Effective search space used: 151096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory