Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate WP_019557121.1 F612_RS0107385 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= BRENDA::B1A0U3 (469 letters) >NCBI__GCF_000381085.1:WP_019557121.1 Length = 436 Score = 143 bits (361), Expect = 1e-38 Identities = 113/374 (30%), Positives = 179/374 (47%), Gaps = 30/374 (8%) Query: 40 EHQHSAHNYHPLP-----IVFAHAKGSSVWDPEGNKYIDFLSGYSAVNQGHCHPKILKAL 94 + QH H Y +P I +GS + +G + ID +S + A G+ HP I +A+ Sbjct: 16 DQQHVWHPYAKIPNPNPVIGVTKTQGSILTLADGCEVIDGMSSWWAAIHGYNHPFIQQAM 75 Query: 95 HDQADRLT-VSSRAFYNDRFPVFAEYLTALF--GYDMVLPMNTGAEGVETALKLARKWGY 151 H+Q + + + + A+ L L G V ++G+ +E A+K+A ++ Sbjct: 76 HNQIEIMPHIMFGGLTHQPAIELAKRLIHLTPPGLVKVFFSDSGSVAMEVAIKMALQFWI 135 Query: 152 EKKKIPNDEALIVSCCGCFNGRTLGVISMSC----------DNEATRGFGPL--MPGHLK 199 K K + L V ++G T ++ S DN A F P M ++ Sbjct: 136 SKNKPEKNRLLTVR--NGYHGDTFATMATSDPDNGMHHIFNDNLAHHIFAPAPEMGFSIE 193 Query: 200 VDFGDAEAIERIFKEKGDRVAAFILEPI-QGEAGVVIPPDGYLKAVRDLCSKYNVLMIAD 258 D D +A E + + +A ++EPI QG G+ YL VR LC++Y+VL+I D Sbjct: 194 SDNSDIQAFEALLEAHHTSIATVVIEPIAQGAGGMRFYRPDYLNRVRMLCTQYDVLLIID 253 Query: 259 EIQTGLARTGKMLACDWEDVRPDVVILGKALGGGILPVSAVLADKDVMLCIKPG-----Q 313 EI TG RTGK+ AC+W D+ PD++ +GKAL GG + ++A L + + I G Sbjct: 254 EIATGFGRTGKLFACEWADIAPDIMCVGKALTGGYMTLAATLCSQTISDTISNGNPGLLM 313 Query: 314 HGSTFGGNPLASAVAIAALEVIKEERLTERSTKLGGELLGLLHKIQKKHPEHVKEVRGKG 373 HG TF NPLA A AIA+++++ + + ++ L L + K E V + R G Sbjct: 314 HGPTFMANPLACATAIASIDLLLDSPWQQNIQRIERHLQATL--LPLKDIEGVADTRVLG 371 Query: 374 LFIGVELNSESLSP 387 VEL + L P Sbjct: 372 AIGVVELERDDLGP 385 Lambda K H 0.319 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 469 Length of database: 436 Length adjustment: 33 Effective length of query: 436 Effective length of database: 403 Effective search space: 175708 Effective search space used: 175708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory