Align Acetylornithine aminotransferase 1; ACOAT 1; EC 2.6.1.11 (uncharacterized)
to candidate WP_019557121.1 F612_RS0107385 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= curated2:Q7W7H6 (393 letters) >NCBI__GCF_000381085.1:WP_019557121.1 Length = 436 Score = 149 bits (375), Expect = 2e-40 Identities = 120/360 (33%), Positives = 177/360 (49%), Gaps = 34/360 (9%) Query: 9 YARLP-------VSFTHGRGVWLWDTGERRYLDALAGIGVSCLGHGHPGLVAAISEQAAR 61 YA++P V+ T G + L D E +D ++ + G+ HP + A+ Q Sbjct: 24 YAKIPNPNPVIGVTKTQGSILTLADGCE--VIDGMSSWWAAIHGYNHPFIQQAMHNQIEI 81 Query: 62 LIHTSNIYEVPQQAA-LARRLAELS--GMSEVLFSNSGSEANEAAIKLARYYGYKQGNTH 118 + H Q A LA+RL L+ G+ +V FS+SGS A E AIK+A + + Sbjct: 82 MPHIMFGGLTHQPAIELAKRLIHLTPPGLVKVFFSDSGSVAMEVAIKMALQFWISKNKPE 141 Query: 119 AH-IITMDSSWHGRTLATLAATGSDK----------ARQGFGPMPS-GF-IQVPYNDLPA 165 + ++T+ + +HG T AT+A + D A F P P GF I+ +D+ A Sbjct: 142 KNRLLTVRNGYHGDTFATMATSDPDNGMHHIFNDNLAHHIFAPAPEMGFSIESDNSDIQA 201 Query: 166 IRAAGEAEPR--VTAVLLEVLQGEGGIRPSDMAFLRGVRQLCTERGWLLMIDEVQSGIGR 223 A EA T V+ + QG GG+R +L VR LCT+ LL+IDE+ +G GR Sbjct: 202 FEALLEAHHTSIATVVIEPIAQGAGGMRFYRPDYLNRVRMLCTQYDVLLIIDEIATGFGR 261 Query: 224 TGKWFAHQWADIRPDVMTLAKGLAGG-VPIGAMLAAGPAAGVFAPGS-----HGTTFGGG 277 TGK FA +WADI PD+M + K L GG + + A L + + + G+ HG TF Sbjct: 262 TGKLFACEWADIAPDIMCVGKALTGGYMTLAATLCSQTISDTISNGNPGLLMHGPTFMAN 321 Query: 278 PLACAAGLAVIDAIEQEGLLANAHEVGAHLHAALASELAGVPGIIEVRGHGLMLGIELDR 337 PLACA +A ID + N + HL A L L + G+ + R G + +EL+R Sbjct: 322 PLACATAIASIDLLLDSPWQQNIQRIERHLQATLL-PLKDIEGVADTRVLGAIGVVELER 380 Lambda K H 0.320 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 436 Length adjustment: 31 Effective length of query: 362 Effective length of database: 405 Effective search space: 146610 Effective search space used: 146610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory