Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_019557573.1 F612_RS0109700 homoserine O-acetyltransferase
Query= SwissProt::F7XKY8 (492 letters) >NCBI__GCF_000381085.1:WP_019557573.1 Length = 390 Score = 370 bits (950), Expect = e-107 Identities = 188/378 (49%), Positives = 257/378 (67%), Gaps = 8/378 (2%) Query: 6 LGIVETKYYHLEEELKLESGRKISDVTIAYEAYGTLNRDKNNVILVCHALTGDAHAAGWH 65 LG++ + H+E+ L L SG + + YE YG LN +N IL+CHAL+GD H AG Sbjct: 5 LGVITPQTLHIEQPLTLSSGSILPRYDLIYETYGQLNASASNGILICHALSGDHHVAGLD 64 Query: 66 KGDNKPGWWDILIGPGKCLDTDKYFIVCSNVIGGCRGSTGPSSIDPETGKPYGLSFPVIT 125 +NKPGWW+ IGPGK +DTD +F+VCSN +GGC GSTGP++++PETGK YG FP++T Sbjct: 65 -ANNKPGWWNDYIGPGKPIDTDHFFVVCSNNLGGCHGSTGPTTLNPETGKVYGPDFPIVT 123 Query: 126 IKDMVNAQKKLLDHLGISSIYAVIGGSMGGLQVLQWSVSYPDYINKAIALAASAYSSPQQ 185 +D VN+Q +L HLGI+ A+IGGSMGG+QVLQW++ YPD + AI +AA+ S Q Sbjct: 124 CRDWVNSQNELRKHLGINQWAALIGGSMGGMQVLQWAIDYPDKLQHAIVIAAAPKLSAQN 183 Query: 186 IAFNEVARIAIISDPEWNKGNYY-YSRQPSHGLALARMIGHITYLSDESMREKFGRELQD 244 IAFNEVAR AI++DP++++G + + P GLA ARM+GH+TYLSD+ M KFGRE + Sbjct: 184 IAFNEVARRAIMTDPDFHEGRFLEHKTVPKQGLAQARMLGHLTYLSDDMMGAKFGRE-RR 242 Query: 245 RDRYNYDLSMDFQVESYLHYKGRSF--TERFDANSYLYITKAVDYFDLTE--NGSLIDGL 300 +D Y+ ++FQVESYL Y+G F T+ FDAN+YL +TKA+DYFD + L L Sbjct: 243 KDELQYNYEVEFQVESYLRYQGEKFATTQNFDANTYLLMTKALDYFDPASEFDHDLSKTL 302 Query: 301 KDIKAKCLIIAVTSDWLYPPYQSKDIVMALNANNVDVTYREIESNYGHDAFLLEAGQLNY 360 AK L+IA T+DW + P +S +IV AL N+ DV+Y E+ES +GHDAFLL Sbjct: 303 AQTTAKFLVIAFTTDWRFAPARSHEIVKALLDNDTDVSYAEVESEHGHDAFLLRNEHYEG 362 Query: 361 VIGGFLNNITVSDIMKLD 378 + ++ I +S+I LD Sbjct: 363 LFRAYMQRI-ISEITPLD 379 Lambda K H 0.318 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 492 Length of database: 390 Length adjustment: 32 Effective length of query: 460 Effective length of database: 358 Effective search space: 164680 Effective search space used: 164680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_019557573.1 F612_RS0109700 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.24577.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-143 461.5 0.0 1.1e-142 461.3 0.0 1.0 1 lcl|NCBI__GCF_000381085.1:WP_019557573.1 F612_RS0109700 homoserine O-acet Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000381085.1:WP_019557573.1 F612_RS0109700 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 461.3 0.0 1.1e-142 1.1e-142 2 350 .. 16 368 .. 15 369 .. 0.97 Alignments for each domain: == domain 1 score: 461.3 bits; conditional E-value: 1.1e-142 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedkGWWdellGpgraldt 70 e++ltl sG++l+++++ y+tyG+lna+ +N +l+cHal+g++hvag ++++GWW++++Gpg+++dt lcl|NCBI__GCF_000381085.1:WP_019557573.1 16 EQPLTLSSGSILPRYDLIYETYGQLNASASNGILICHALSGDHHVAGLDANNKPGWWNDYIGPGKPIDT 84 589*******************************************99999999*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +++fvvc+N+lG+c+GstgP+++npetgk yg++fP vt rD+v+ q++l ++Lg++++aa +GgS+GG lcl|NCBI__GCF_000381085.1:WP_019557573.1 85 DHFFVVCSNNLGGCHGSTGPTTLNPETGKVYGPDFPIVTCRDWVNSQNELRKHLGINQWAALIGGSMGG 153 ********************************************************************* PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARml 207 mq+l+wa++yp+++++++v+a+++++saq+iafnev+r+ai++Dp++++G++ e++ P++GLa ARml lcl|NCBI__GCF_000381085.1:WP_019557573.1 154 MQVLQWAIDYPDKLQHAIVIAAAPKLSAQNIAFNEVARRAIMTDPDFHEGRFLEHKtVPKQGLAQARML 222 ******************************************************999************ PP TIGR01392 208 alltYrseesleerfgreakseeslassleeefsvesylryqgkkfv..erFdAnsYllltkaldthdl 274 ++ltY+s++ + ++fgre++++ +l++++e ef+vesylryqg+kf+ + FdAn+Yll+tkald++d lcl|NCBI__GCF_000381085.1:WP_019557573.1 223 GHLTYLSDDMMGAKFGRERRKD-ELQYNYEVEFQVESYLRYQGEKFAttQNFDANTYLLMTKALDYFDP 290 ****************999888.78999******************73368****************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekek 341 a + +++l+++l++++a++lv+++++D++f++++++e++kal +++++ yae+ese+GHDaFll +e+ lcl|NCBI__GCF_000381085.1:WP_019557573.1 291 ASEFDHDLSKTLAQTTAKFLVIAFTTDWRFAPARSHEIVKALLDNDTDvsYAEVESEHGHDAFLLRNEH 359 ******************************************98888778******************* PP TIGR01392 342 veelirefl 350 +e l r+++ lcl|NCBI__GCF_000381085.1:WP_019557573.1 360 YEGLFRAYM 368 999988876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.28 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory