Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95; 2-oxoglutarate reductase; EC 1.1.1.399 (uncharacterized)
to candidate WP_019557699.1 F612_RS0110335 DUF3410 domain-containing protein
Query= curated2:P35136 (525 letters) >NCBI__GCF_000381085.1:WP_019557699.1 Length = 380 Score = 105 bits (262), Expect = 3e-27 Identities = 89/284 (31%), Positives = 139/284 (48%), Gaps = 30/284 (10%) Query: 22 DFIEIVQKNVADAEDELHTFDALLVRSATKVTEDLFNKMTSLKIVGRAGVGVDNIDIDEA 81 + + + KN+ DA H DAL+VRS T+V +L K +S++ VG VG+D+ID Sbjct: 25 EVVTLPGKNI-DAASIKHA-DALIVRSRTQVNAELL-KGSSVQFVGSTVVGLDHIDQTYL 81 Query: 82 TKHGVIVINAPNGNTISTAEHTFAMISSLMRHIPQANISVKSREWNRTAYVGSELYGKTL 141 + G+ +A N S AE + + L +++E++ T KTL Sbjct: 82 KEKGITFYSAQGCNANSVAEFVISALFDL----------AETKEFDLTQ--------KTL 123 Query: 142 GIVGLGRIGSEIAQRARAFGMTVHVFDPFLTEERAKKIGVNSRTFEEVLESADIITVHTP 201 GI+G+G +G + ++A A G+T + DP ++ + S E ADIIT HTP Sbjct: 124 GIIGVGHVGHLVHEKATALGITCLLNDPPRQRQQTLENSQESFVDLETCLKADIITFHTP 183 Query: 202 LT----KETKGLLNKETIAKTKKGVRLINCARGGIIDEAALLEALENGHVAGAALDVFEV 257 LT T LL+ E + K LIN ARGGII+E+A + +V +D +E Sbjct: 184 LTVSGQDATLDLLSAERLEKILPHQILINAARGGIINESAWCKTPTLANV----IDCWEN 239 Query: 258 EPPVDNKLVDHPLVIATPHLGASTKEAQLNVAAQVSEEVLQFAK 301 EP + L +ATPH+ + EA++ + V + + F K Sbjct: 240 EPTISESLY-KTAYLATPHIAGHSLEAKVAGSEMVYQALCNFWK 282 Lambda K H 0.317 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 525 Length of database: 380 Length adjustment: 33 Effective length of query: 492 Effective length of database: 347 Effective search space: 170724 Effective search space used: 170724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory