Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_019557719.1 F612_RS0110440 aspartate aminotransferase family protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >NCBI__GCF_000381085.1:WP_019557719.1 Length = 392 Score = 275 bits (702), Expect = 2e-78 Identities = 151/366 (41%), Positives = 222/366 (60%), Gaps = 14/366 (3%) Query: 30 RGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHVSNVFTNEPALRL 89 +G G+ + D G+ +D GIAV LGHAHP + A+ +Q+ +L H SN++ + L Sbjct: 18 KGDGATLQDSEGKMYLDAISGIAVTSLGHAHPFISEAICKQSQQLIHTSNLYHIKKQQML 77 Query: 90 AHKLVDATFAERVFFCNSGAEANEAAFKLARRVAHDRFGTEKYEIVAALNSFHGRTLFTV 149 A +L++ + E+VFFCNSGAEANEAA K+A++ H + G IV NSFHGRT+ T+ Sbjct: 78 ADQLIELSGMEQVFFCNSGAEANEAAIKIAKKFGHQQ-GITNPTIVVMENSFHGRTMATL 136 Query: 150 NVGGQSKYSDGFGPKITGITHVPYNDLAALKAAVSDKTC-AVVLEPIQGEGGVLPAELSY 208 + G K +GF P + G T VP++++AA++A ++ A+++EPIQGEGGV + Y Sbjct: 137 SATGNPKVHEGFQPLVGGFTRVPFDNVAAVEALSDNRDIVAILVEPIQGEGGVYVPQKGY 196 Query: 209 LQGARELCDAHNALLVFDEVQTGMGRSGKLFAYQHYGVTPDILTSAKSLGGGFPIAAMLT 268 L+ R++CDA+N LL+ DE+QTGMGR+G+ FA+QH +TPD+LT AK+LG G PI A + Sbjct: 197 LKALRKICDANNWLLMIDEIQTGMGRTGQWFAFQHENITPDVLTLAKALGNGVPIGACIA 256 Query: 269 TEDLAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLNGVNAKH----DKFKTRLEQ 324 L G HGTT+GGNPLACAV AVI+V+ T + + K ++FK+ L Q Sbjct: 257 NNKATDVLAPGNHGTTFGGNPLACAVGLAVIEVLKTHNYIPAIAKKGALLLNQFKSALTQ 316 Query: 325 IGEKYGLFTEVRGLGLLLGCVLSDAWKGKAKDIFNAAEREGLMILQAGPDVIRFAPSLVV 384 + G+ + +RG G ++G L ++ A GL+I D +R PS V+ Sbjct: 317 ---QPGI-SSIRGQGYMIGIQLD----RPCAELVKMALERGLLINVTRGDTVRLLPSFVM 368 Query: 385 EDADID 390 D Sbjct: 369 SQQQTD 374 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 392 Length adjustment: 31 Effective length of query: 375 Effective length of database: 361 Effective search space: 135375 Effective search space used: 135375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory