Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_019864898.1 METMI_RS0103720 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_000384075.1:WP_019864898.1 Length = 404 Score = 351 bits (901), Expect = e-101 Identities = 197/399 (49%), Positives = 258/399 (64%), Gaps = 8/399 (2%) Query: 12 QLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHLFDE 71 ++P + G+ L TA AG+K+ DL L+A+ S+ AVFT N FCAAPV +AK+HL Sbjct: 10 EMPAVAGVTLGTACAGIKQTVKDDLLLVAMPEQSSCAAVFTQNAFCAAPVQVAKAHL--P 67 Query: 72 DGVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPADKI 131 R L++N+GNANAGTGAQG DAL CA A +G QV+PFSTGVI +PLP KI Sbjct: 68 HSPRWLLVNSGNANAGTGAQGMQDALMGCAELAGLVGGTAQQVLPFSTGVIGQPLPMAKI 127 Query: 132 IAALPK----MQPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPN 187 LP + + W +AA+AIMTTDT PK S+ V D H+V GIAKG+GMIHP+ Sbjct: 128 TTTLPATVADLSESHWGKAAKAIMTTDTFPKGVSKVLMV-DGHSVTINGIAKGAGMIHPD 186 Query: 188 MATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQSEID 247 MAT+L F+ATDA V +LQ +++FN ITVDGDTSTND+ V++A+G ++ EI Sbjct: 187 MATLLVFMATDACVKPDLLQACLAAAVEQSFNRITVDGDTSTNDACVLLASGCSAAPEI- 245 Query: 248 NIADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAAARSP 307 Y + + +LA+ +VRDGEGATK + + V A + +EA + A A SP Sbjct: 246 LAGTGHYEAFAAAVMEVCKQLAELVVRDGEGATKLMRIIVGEAASEEEAVRVAKTIAHSP 305 Query: 308 LVKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQGQAV 367 LVKTAFFASDPN G+ LAA+G A V + + V++YL D+ + +GGRA YTE GQAV Sbjct: 306 LVKTAFFASDPNWGRILAAVGRAGVEAMVLEDVQIYLGDVCIVNNGGRALDYTEEAGQAV 365 Query: 368 MSKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 M K EIT+ +KL RG V TCD S+ YV INA+YR+ Sbjct: 366 MDKAEITITVKLGRGAFTQEVLTCDFSYDYVKINAEYRT 404 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 404 Length adjustment: 31 Effective length of query: 375 Effective length of database: 373 Effective search space: 139875 Effective search space used: 139875 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory