Align Carbamoyl-phosphate synthase small chain; EC 6.3.5.5; Carbamoyl-phosphate synthetase glutamine chain (uncharacterized)
to candidate WP_019865233.1 METMI_RS0105370 type 1 glutamine amidotransferase
Query= curated2:Q8XHB2 (349 letters) >NCBI__GCF_000384075.1:WP_019865233.1 Length = 196 Score = 82.4 bits (202), Expect = 9e-21 Identities = 60/194 (30%), Positives = 99/194 (51%), Gaps = 20/194 (10%) Query: 170 KVAIIDF--GIKQNIIRNFVKRGCNVTVFPYD-FKAEEVLEINPDLVFLSNGPGDPEDMG 226 KV +ID N+++ F + G +VTV D +E+ + PD + +S GP P++ G Sbjct: 5 KVVMIDNYDSFTYNLVQYFGELGADVTVVRNDQVTVDEIQRLCPDKIVISPGPCSPKEAG 64 Query: 227 EAVNEIKKIVGKKPIVGICLGHQLLALTLGGE---TKKLKFGHRGC--NHPV---KDLIN 278 +V I K G+ P++G+CLGHQ + GG+ K++ G +H V K L N Sbjct: 65 VSVEAILKFAGRIPVLGVCLGHQSIGYAFGGQIIHAKRIMHGKTSLVYHHDVGVFKGLSN 124 Query: 279 NRVHITSQNHGYYVA--TLPENMEITHVSMNDG----TVEGMKHKELPIFSVQFHPEACP 332 ++ H + +LPE +EIT + ++G + G++HK L + VQFHPE+ Sbjct: 125 --PFTATRYHSLVIGQDSLPECLEITAWTQDEGGNIDEIMGVRHKTLDVEGVQFHPESIL 182 Query: 333 GPKDSEYIFDEFMK 346 + + D F+K Sbjct: 183 -TEHGHDLLDNFLK 195 Lambda K H 0.318 0.139 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 196 Length adjustment: 24 Effective length of query: 325 Effective length of database: 172 Effective search space: 55900 Effective search space used: 55900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory