Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (uncharacterized)
to candidate WP_019865312.1 METMI_RS0105755 glycosyl transferase family protein
Query= curated2:Q30VM1 (331 letters) >NCBI__GCF_000384075.1:WP_019865312.1 Length = 340 Score = 72.0 bits (175), Expect = 2e-17 Identities = 70/233 (30%), Positives = 107/233 (45%), Gaps = 15/233 (6%) Query: 4 AEILETLASGGV----LPPETAHMAFDRLMSGEMTPAQAGSFLMGLRSHGETPELVASAV 59 AEI+ L G L E AH A +++ E+ P Q G+FLM +R ETP+ +A V Sbjct: 17 AEIVRILGKGKKGSRPLTQEEAHRAMKMILADEVLPVQLGAFLMLMRVKEETPDELAGFV 76 Query: 60 RAALAHARLIQGLEYDRIDIVGTGGDGRNSFNCSTAAALTLAGMGYKVVKHGNRAVSSTS 119 +AA ++ G D +D G R +AL LA G V HG A ++ Sbjct: 77 QAAWESFQIDNGGLVD-LDWSSYAGK-RRHLPWFLLSALLLAENGVTVFMHG--ASGHSA 132 Query: 120 G---SADVVEGLGLPLETAPEDVPVLLARHNFVFLFAPFYHPAFRHVMPVRRDLGIRTLF 176 G + +++E LGL + + L + F +L + P ++ +R LG+R+ Sbjct: 133 GRLYTENMLEYLGLSCANSVAEARQQLEQRRFSYLSLEHFCPKLHEIIELRPILGLRSPV 192 Query: 177 NVLGPLLNPARPTRMLLGVAKPAM--LHTMADALLLTGVRRAAVVHGAGGYDE 227 + L LLNP + G+ P+ +H +A ALL AV+ G GG E Sbjct: 193 HTLVRLLNPFNAPYSIQGIFHPSYRPVHQLAAALLQQ--PHMAVLKGEGGETE 243 Lambda K H 0.321 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 340 Length adjustment: 28 Effective length of query: 303 Effective length of database: 312 Effective search space: 94536 Effective search space used: 94536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory