Align Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 (characterized)
to candidate WP_019866029.1 METMI_RS26155 diaminopimelate epimerase
Query= SwissProt::P0A6K1 (274 letters) >NCBI__GCF_000384075.1:WP_019866029.1 Length = 503 Score = 329 bits (843), Expect = 8e-95 Identities = 166/274 (60%), Positives = 201/274 (73%), Gaps = 1/274 (0%) Query: 1 MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY 60 + F+KM GLGNDF+V+DA++Q + +PE IR ++DRH G+GFDQLL+VE P DF Y Sbjct: 2 INFTKMQGLGNDFVVIDAISQAIDLTPEHIRFMSDRHFGIGFDQLLLVELPESENADFKY 61 Query: 61 RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE 120 RIFNADGSEVAQCGNGARCFARFVR KGL++K I V T +G++ L+ D DL+ VNMG Sbjct: 62 RIFNADGSEVAQCGNGARCFARFVRDKGLSDKDSICVDTDSGQLTLSF-DHDLITVNMGV 120 Query: 121 PNFEPSAVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLE 180 P P +P A + K Y + + G VSMGNPH VIQV+D+ A V+ +G LE Sbjct: 121 PRHAPEQIPLLAEQESKFYTVSINDTEKAFGAVSMGNPHAVIQVNDIKNAQVKDIGATLE 180 Query: 181 SHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLLAEEVRV 240 SH FPERANIGFMQV+ R HI+LRVYERGAGET ACGSGACAAV VGI+Q LL +EV V Sbjct: 181 SHPFFPERANIGFMQVLDRHHIKLRVYERGAGETLACGSGACAAVVVGIEQHLLDQEVTV 240 Query: 241 ELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL 274 ELPGG L+I+W G G P+ MTG AV V+DG I L Sbjct: 241 ELPGGTLNISWAGRGEPVMMTGEAVSVFDGRISL 274 Lambda K H 0.323 0.140 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 503 Length adjustment: 30 Effective length of query: 244 Effective length of database: 473 Effective search space: 115412 Effective search space used: 115412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_019866029.1 METMI_RS26155 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00652.hmm # target sequence database: /tmp/gapView.22188.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00652 [M=270] Accession: TIGR00652 Description: DapF: diaminopimelate epimerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-96 307.7 0.0 5e-96 307.2 0.0 1.2 1 lcl|NCBI__GCF_000384075.1:WP_019866029.1 METMI_RS26155 diaminopimelate ep Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384075.1:WP_019866029.1 METMI_RS26155 diaminopimelate epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 307.2 0.0 5e-96 5e-96 1 268 [. 2 272 .. 2 274 .. 0.95 Alignments for each domain: == domain 1 score: 307.2 bits; conditional E-value: 5e-96 TIGR00652 1 meFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvep.sseeadvklrifNsDGS 68 ++F+km+GlgNdFv++d + + + + +e +r ++drh+g+g+D++llve +se+ad+k+rifN+DGS lcl|NCBI__GCF_000384075.1:WP_019866029.1 2 INFTKMQGLGNDFVVIDAISQAIDLT-PEHIRFMSDRHFGIGFDQLLLVELpESENADFKYRIFNADGS 69 68******************666666.**********************97699*************** PP TIGR00652 69 eaemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltvekee 137 e+++CGNg+Rcfa+fv++kgl +k+++ v t++g++++ + ++ ++v+mg p+ +e+ipl +e+e+ lcl|NCBI__GCF_000384075.1:WP_019866029.1 70 EVAQCGNGARCFARFVRDKGLSDKDSICVDTDSGQLTLSFDHDL--ITVNMGVPRHAPEQIPLLAEQES 136 ****************************************9987..******************87777 PP TIGR00652 138 ekeellalev...l.vvdvGnPHlvvfvedvekldleelgklleaheefpegvNvefvevkkedeiklr 202 + +++ ++ + +v++GnPH+v++v+d+++++++++g++le+h+ fpe+ N+ f++v+++++iklr lcl|NCBI__GCF_000384075.1:WP_019866029.1 137 KFYTVSINDTekaFgAVSMGNPHAVIQVNDIKNAQVKDIGATLESHPFFPERANIGFMQVLDRHHIKLR 205 766665555566548****************************************************** PP TIGR00652 203 vyERGageTlaCGtGavAsavvalklgktkkkvtvhleggeLeievkedg.kvyltGpavlvlegel 268 vyERGageTlaCG+Ga+A++vv++++ +++++vtv+l+gg L+i++ +g v++tG+av v++g++ lcl|NCBI__GCF_000384075.1:WP_019866029.1 206 VYERGAGETLACGSGACAAVVVGIEQHLLDQEVTVELPGGTLNISWAGRGePVMMTGEAVSVFDGRI 272 **************************************************99*************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (503 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory