Align histidinol-phosphate aminotransferase; tyrosine/phenylalanine aminotransferase (promiscuous) (EC 2.6.1.1; EC 2.6.1.9) (characterized)
to candidate WP_019866295.1 METMI_RS0110735 histidinol-phosphate transaminase
Query= metacyc::BSU22620-MONOMER (360 letters) >NCBI__GCF_000384075.1:WP_019866295.1 Length = 367 Score = 254 bits (650), Expect = 2e-72 Identities = 142/354 (40%), Positives = 208/354 (58%), Gaps = 1/354 (0%) Query: 7 LKQLKPYQPGKPIEAVKSEYGLDKVVKLASNENPYGCSEAAKEALHHEIQQLALYPDGYS 66 +++L PY+ GKPIE ++ E GL +++KLASNENP G + A A+ + +LALYPDG Sbjct: 14 VQKLIPYKAGKPIEELERELGLTQIIKLASNENPLGPGKQAIAAIQKALPELALYPDGSG 73 Query: 67 AALRTRLSKHLNVSETSLIFGNGSDEIIQIICRAFLNDKTNTVTAAPTFPQYKHNAVIEG 126 L+ L+ + + + GNGS+E+++++ RAFL + V + F Y G Sbjct: 74 FHLKQALATKYALDASQITLGNGSNELLELVARAFLIPELEVVFSQHAFAVYPLVTQAVG 133 Query: 127 AEVREIALRPDGSHDLDAMLEAIDEQTQVVWICSPNNPTGTYTSEGELLAFLERVPSRVL 186 A + + G HDL M +A+ +T++V+I +PNNPTGT ++ EL F+ +P V+ Sbjct: 134 ATAVVVPAKEYG-HDLAGMAQAVTAKTRLVFIANPNNPTGTLLAQAELEQFIGALPDTVI 192 Query: 187 VVLDEAYYEYVTAEDYPETVPLLSKYSNLMILRTFSKAYGLAALRVGYGIADENLIRQIE 246 VLDEAY+E+V+ ++ L K+ NL+I RTFSKAYGLA LRVGY ++ + + Sbjct: 193 CVLDEAYFEFVSQSAAINSIDWLKKFPNLIITRTFSKAYGLAGLRVGYSLSCPEIADILN 252 Query: 247 PAREPFNTSRLGQAAAIAALDDQAFIASCVEQNNAGLQQYYDFAKTHGLKCYPSQTNFVL 306 R+PFN + L AAA AAL D+ + + + N G+QQ D K GL PS NFV Sbjct: 253 RVRQPFNNNSLALAAAEAALADEEHLHNTISNNRLGMQQLTDGFKALGLPWIPSAGNFVS 312 Query: 307 IDFKRPADELFQALLEKGYIVRSGNALGFPTSLRITIGTKEQNEEILAILAEIL 360 +D KR +++ALL KG IVR P LRI+IGT +N L L+E+L Sbjct: 313 VDVKREGMPVYEALLRKGVIVRPVANYEMPGFLRISIGTPAENTLFLQALSEVL 366 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 367 Length adjustment: 29 Effective length of query: 331 Effective length of database: 338 Effective search space: 111878 Effective search space used: 111878 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_019866295.1 METMI_RS0110735 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.28803.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-114 366.9 0.0 5.6e-114 366.6 0.0 1.0 1 lcl|NCBI__GCF_000384075.1:WP_019866295.1 METMI_RS0110735 histidinol-phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384075.1:WP_019866295.1 METMI_RS0110735 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 366.6 0.0 5.6e-114 5.6e-114 4 349 .] 14 365 .. 12 365 .. 0.98 Alignments for each domain: == domain 1 score: 366.6 bits; conditional E-value: 5.6e-114 TIGR01141 4 ikklepYqpg......arelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkealak 66 ++kl pY++g +relg ++++kL+snEnP+gp +++++a++++l +l +Ypd ++++lk+ala lcl|NCBI__GCF_000384075.1:WP_019866295.1 14 VQKLIPYKAGkpieelERELGLTQIIKLASNENPLGPGKQAIAAIQKALPELALYPDGSGFHLKQALAT 82 89******************************************************************* PP TIGR01141 67 ylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedlea 135 ++ +++ +i+lgnGs+el+el++rafl p+ +v+++++++++Y++++++ ga + vp+ke g +dl+ lcl|NCBI__GCF_000384075.1:WP_019866295.1 83 KYALDASQITLGNGSNELLELVARAFLIPELEVVFSQHAFAVYPLVTQAVGATAVVVPAKEYG-HDLAG 150 **************************************************************6.9**** PP TIGR01141 136 vleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellaeyp 200 +++a++ k++lvf+a+PnnPtG+ll ++e+e+++ + ++++V+DeAY eF ++ + +++l+++p lcl|NCBI__GCF_000384075.1:WP_019866295.1 151 MAQAVTAKTRLVFIANPNNPTGTLLAQAELEQFIGALpDTVICVLDEAYFEFVSQsaaINSIDWLKKFP 219 *************************************77***************98888999******* PP TIGR01141 201 nlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkke 269 nl+++rT+SKa+gLAglRvGy ++++ei+++l++vr+p+n +slal+aa aal d++++++t+ +++ + lcl|NCBI__GCF_000384075.1:WP_019866295.1 220 NLIITRTFSKAYGLAGLRVGYSLSCPEIADILNRVRQPFNNNSLALAAAEAALADEEHLHNTISNNRLG 288 ********************************************************************* PP TIGR01141 270 rerlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtree 338 +++l++++k+l gl +++S +NFv ++vk++ ++eall+kg+ivR ++++e ++++lRi++Gt+ e lcl|NCBI__GCF_000384075.1:WP_019866295.1 289 MQQLTDGFKAL-GLPWIPSAGNFVSVDVKREGMPVYEALLRKGVIVRPVANYE--MPGFLRISIGTPAE 354 ***********.8***************************************5..5************* PP TIGR01141 339 nerllealkei 349 n+ +l+al+e+ lcl|NCBI__GCF_000384075.1:WP_019866295.1 355 NTLFLQALSEV 365 ********985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.78 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory