Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_019866313.1 METMI_RS0110825 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >NCBI__GCF_000384075.1:WP_019866313.1 Length = 276 Score = 275 bits (704), Expect = 6e-79 Identities = 146/271 (53%), Positives = 184/271 (67%), Gaps = 3/271 (1%) Query: 2 DQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGG-NVT 60 D+Y VFG PIGHSKSP IH+ FA QTGQ L Y ++F + FF QG G N T Sbjct: 3 DRYAVFGQPIGHSKSPRIHQFFAGQTGQQLSYTAEEVAPEQFVGSVKAFFAQGGLGLNCT 62 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VP KE AF D+ T RA+RA AVNTL ADG++ GDNTDG GLV DL N L G Sbjct: 63 VPLKELAFAFADTKTIRAQRAKAVNTLKLEADGSVLGDNTDGCGLVTDLLDNHAFNLKGS 122 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWL-QE 179 RIL+LGAGGA RG++ P+L + PQ++VIANRTVEKA +LA EF ++G + G+A L + Sbjct: 123 RILLLGAGGASRGIIAPLLGYSPQTVVIANRTVEKAVELAAEFQDIGVISGCGYADLGGQ 182 Query: 180 PVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGL 239 D+I+NATSASL+GELPP+ ++ A + VCYD+ YG +PT F +W + GA LDGL Sbjct: 183 AFDIILNATSASLSGELPPLPQGVL-ATQGVCYDLAYGDQPTAFVRWGRENGAFYSLDGL 241 Query: 240 GMLAEQAAEAFFIWRGVRPDTAPVLAELRRQ 270 GML EQAA AF++WRGVRP T ++ L + Sbjct: 242 GMLVEQAAAAFYLWRGVRPSTHALIELLNAE 272 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 276 Length adjustment: 25 Effective length of query: 249 Effective length of database: 251 Effective search space: 62499 Effective search space used: 62499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_019866313.1 METMI_RS0110825 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.3788.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-81 257.7 0.0 6.3e-81 257.4 0.0 1.0 1 lcl|NCBI__GCF_000384075.1:WP_019866313.1 METMI_RS0110825 shikimate dehydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384075.1:WP_019866313.1 METMI_RS0110825 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 257.4 0.0 6.3e-81 6.3e-81 3 265 .. 5 269 .. 3 272 .. 0.95 Alignments for each domain: == domain 1 score: 257.4 bits; conditional E-value: 6.3e-81 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlell 71 ++v+G+pi hSksp ih+ ++ q+g++l Y+a ev +e++ +++++a+g G+n TvP+Ke +++++ lcl|NCBI__GCF_000384075.1:WP_019866313.1 5 YAVFGQPIGHSKSPRIHQFFAGQTGQQLSYTAEEVAPEQFVGSVKAFFAQGGLGLNCTVPLKELAFAFA 73 9******************************************************************** PP TIGR00507 72 DeieesakligavNTlkle.dgklvgynTDgiGlvssLek..lsklksekrvliiGAGGaakavaleLl 137 D + +a+ ++avNTlkle dg ++g+nTDg Glv++L +lk + r+l++GAGGa+++++ +Ll lcl|NCBI__GCF_000384075.1:WP_019866313.1 74 DTKTIRAQRAKAVNTLKLEaDGSVLGDNTDGCGLVTDLLDnhAFNLK-GSRILLLGAGGASRGIIAPLL 141 *****************764899**************9886344555.9*******************9 PP TIGR00507 138 ka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellk 205 +++v+iaNRtveka ela ++q +g i +++ + +d+i+natsa+lsge+ +++++++l+ lcl|NCBI__GCF_000384075.1:WP_019866313.1 142 GYsPQTVVIANRTVEKAVELAAEFQDIGVISGCGYADLGGQAFDIILNATSASLSGEL--PPLPQGVLA 208 8879******************************************************..********* PP TIGR00507 206 egklvvDlvynpletpllkeakkkg.tkvidGlgMlvaQaalsFelwtgvepdvekvfeal 265 ++ +++Dl+y t+++++ +++g +dGlgMlv+Qaa +F lw+gv p +e l lcl|NCBI__GCF_000384075.1:WP_019866313.1 209 TQGVCYDLAYGDQPTAFVRWGRENGaFYSLDGLGMLVEQAAAAFYLWRGVRPSTHALIELL 269 *************************88999*********************9988877765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (276 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory