Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_019866777.1 METMI_RS0113260 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000384075.1:WP_019866777.1 Length = 263 Score = 163 bits (413), Expect = 3e-45 Identities = 85/252 (33%), Positives = 139/252 (55%), Gaps = 1/252 (0%) Query: 10 RLTDVIDRLLAPE-GCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMFL 68 +L ++++L PE GCPWD +Q +L Y++EE +E+V+AI + D++R E+GD++ Sbjct: 7 QLLSIMEQLRHPEQGCPWDLKQDFSTLIPYVIEEAYEVVDAIERNDHDDLRSELGDLLLQ 66 Query: 69 LAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAEKAD 128 + F +L + G F + + K++RRHPHVF D +A+ ++ + WE K E+ + Sbjct: 67 VVFQAQLAKELGLFDFEAIAESIGDKLVRRHPHVFGDAVFANDEQRHQAWEQAKALERLE 126 Query: 129 AEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVLAGD 188 + E G + ASLP L+ + +I +AA+ GF WP+ V +V E E+ + Sbjct: 127 KQPEMTGALAGITASLPALMASEKIQDRAAQQGFDWPDVPPVFEKVLEELNEVKEAWQSG 186 Query: 189 DKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLDFPALS 248 D+A + E+GDL+F V L R + AL ++ KF +RF+ +E G Sbjct: 187 DQAHIQEEIGDLLFVAVNLARHLKVSPEIALKQSSQKFTKRFQYIEQHVAASGRGMTDCE 246 Query: 249 LDDKDELWNEAK 260 L + D LWNEAK Sbjct: 247 LAELDALWNEAK 258 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 263 Length adjustment: 25 Effective length of query: 242 Effective length of database: 238 Effective search space: 57596 Effective search space used: 57596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory