Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate WP_019866822.1 METMI_RS0113510 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >NCBI__GCF_000384075.1:WP_019866822.1 Length = 377 Score = 462 bits (1189), Expect = e-135 Identities = 227/373 (60%), Positives = 273/373 (73%) Query: 4 TQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKAPVV 63 + +LEL K LISRPSVTP D CQ+LLAE L +GF AE L F DT+NIWLRRG P+ Sbjct: 2 SDTLELLKTLISRPSVTPQDAGCQELLAECLAPLGFTAERLDFADTQNIWLRRGQDKPLF 61 Query: 64 CFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHPNH 123 F GHTDVVP G + WDSPPFEP +DG+LYGRGAADMK IA FVTA RF+AKHP+H Sbjct: 62 TFLGHTDVVPPGSLSAWDSPPFEPTIKDGKLYGRGAADMKGGIAAFVTAVGRFLAKHPDH 121 Query: 124 QGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRGSL 183 QGSIA+++TSDEEG A G KVVDVL+ R E ID+C+VGEP++ ++GD+I+ GRRGSL Sbjct: 122 QGSIAVMMTSDEEGIATHGVVKVVDVLEQRGEKIDWCLVGEPSSDKRIGDVIRVGRRGSL 181 Query: 184 SGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGGTG 243 LTV G QGH+AYP LA NP+HTFAPAL LT+EVWD+GNE+FPPT Q+SNINGGTG Sbjct: 182 CARLTVIGIQGHVAYPELAENPIHTFAPALKALTEEVWDQGNEFFPPTRLQVSNINGGTG 241 Query: 244 ATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAGKLT 303 A N+IPG L+V+FN RF TE ++QR HAILD G +Y L W SGQPFLT +G+L Sbjct: 242 AENIIPGHLDVQFNLRFCTELDAQTIQQRTHAILDPFGFKYQLDWRLSGQPFLTASGELV 301 Query: 304 DVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDIPK 363 AAI G T GGTSDGRFI ++IELGP N +IH+INE++ L D+ Sbjct: 302 AATHAAIKSVTGYAPLDDTGGGTSDGRFIAPTGAQVIELGPLNESIHKINEHIGLEDLET 361 Query: 364 LSAVYEGILARLL 376 LSA+YE +L LL Sbjct: 362 LSAIYEQVLVNLL 374 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 377 Length adjustment: 30 Effective length of query: 351 Effective length of database: 347 Effective search space: 121797 Effective search space used: 121797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_019866822.1 METMI_RS0113510 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.12482.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-167 542.5 0.0 2.7e-167 542.3 0.0 1.0 1 lcl|NCBI__GCF_000384075.1:WP_019866822.1 METMI_RS0113510 succinyl-diamino Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000384075.1:WP_019866822.1 METMI_RS0113510 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.3 0.0 2.7e-167 2.7e-167 2 370 .] 5 373 .. 4 373 .. 1.00 Alignments for each domain: == domain 1 score: 542.3 bits; conditional E-value: 2.7e-167 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaG 70 lel+k Lisr+svtP+dag+qel+ae L lgf++e+l f dt+n+w++rg+++p ++f GhtDvvP G lcl|NCBI__GCF_000384075.1:WP_019866822.1 5 LELLKTLISRPSVTPQDAGCQELLAECLAPLGFTAERLDFADTQNIWLRRGQDKPLFTFLGHTDVVPPG 73 689****************************************************************** PP TIGR01246 71 elekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtk 139 +l++W+s+pfep+++dGklygrGaaDmkg++aafv+a+ rf++k++dh+Gs+++++tsDeeg a +G++ lcl|NCBI__GCF_000384075.1:WP_019866822.1 74 SLSAWDSPPFEPTIKDGKLYGRGAADMKGGIAAFVTAVGRFLAKHPDHQGSIAVMMTSDEEGIATHGVV 142 ********************************************************************* PP TIGR01246 140 kvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvl 208 kvv++l++r e+id+++vgePss k++GDvi++GrrGs+ ++l++ GiqGhvaYP++aenP+h+++p+l lcl|NCBI__GCF_000384075.1:WP_019866822.1 143 KVVDVLEQRGEKIDWCLVGEPSSDKRIGDVIRVGRRGSLCARLTVIGIQGHVAYPELAENPIHTFAPAL 211 ********************************************************************* PP TIGR01246 209 keliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkl 277 k+l+++ +D+Gneffpp++lq++ni++gtga n+iPg+l+v+fnlrf++e+ +++++++ ++ild ++ lcl|NCBI__GCF_000384075.1:WP_019866822.1 212 KALTEEVWDQGNEFFPPTRLQVSNINGGTGAENIIPGHLDVQFNLRFCTELDAQTIQQRTHAILDPFGF 280 ********************************************************************* PP TIGR01246 278 dYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihk 346 +Y+l+w+lsg+pflt +g+l+++ ++ai+ v++ +p +t+GGtsD+rfia ga+v+elG++n++ihk lcl|NCBI__GCF_000384075.1:WP_019866822.1 281 KYQLDWRLSGQPFLTASGELVAATHAAIKSVTGYAPLDDTGGGTSDGRFIAPTGAQVIELGPLNESIHK 349 ********************************************************************* PP TIGR01246 347 vneavkiedleklsevyeklleel 370 +ne++ +edle ls++ye++l +l lcl|NCBI__GCF_000384075.1:WP_019866822.1 350 INEHIGLEDLETLSAIYEQVLVNL 373 *********************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 6.98 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory