Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate WP_019868452.1 METMI_RS0121960 phosphoribosyl-AMP cyclohydrolase
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >NCBI__GCF_000384075.1:WP_019868452.1 Length = 128 Score = 84.7 bits (208), Expect = 6e-22 Identities = 49/127 (38%), Positives = 69/127 (54%), Gaps = 8/127 (6%) Query: 9 ELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETS 68 E+ W +GL+PVI Q A +G V+M +MN E+L T + G ++SR++ +LW KGE S Sbjct: 6 EIRWTP-EGLVPVIAQQAGNGRVVMFAWMNRESLALTAQEGYAVYWSRSRNKLWRKGEES 64 Query: 69 GNFLNVVSIAPDCDNDTLLV-LANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQLLAERKS 127 G+ V+SI DCD D +L+ + G CH G SCF + L + E Sbjct: 65 GHRQKVISIQLDCDGDVILLEIEQEGGIACHTGRESCF------YRQLVDGQWQAVEAVI 118 Query: 128 ADPETSY 134 DPET Y Sbjct: 119 KDPETIY 125 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 74 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 128 Length adjustment: 17 Effective length of query: 186 Effective length of database: 111 Effective search space: 20646 Effective search space used: 20646 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory