Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_019896009.1 A377_RS0109055 O-succinylhomoserine sulfhydrylase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000384235.1:WP_019896009.1 Length = 399 Score = 475 bits (1223), Expect = e-139 Identities = 230/384 (59%), Positives = 301/384 (78%), Gaps = 1/384 (0%) Query: 21 TLAVRAGQRRTPEGEHGEALFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTVRTFEE 80 TLA+RAG ++T E E+ EA+F TSS+ + +A AA RF+G+ PGNVYSR+TNPTV+ FE Sbjct: 10 TLAIRAGYQQTAEQENSEAIFPTSSFRYHSAQQAADRFSGDEPGNVYSRFTNPTVQAFER 69 Query: 81 RIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKRFGIQV 140 R+AA+E E VATASGMSAILA +M L +GDH++ S+SVFG+T LFD+Y ++FGI+V Sbjct: 70 RLAAMEEGEACVATASGMSAILASMMGLLQAGDHLVCSQSVFGTTRVLFDQYLRKFGIEV 129 Query: 141 DYPPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALLAVDNCFCTP 200 Y PL+D AAW+ A + NT+L F+E+PSNPL+E+ DIA L E+A A A L VDNCFCTP Sbjct: 130 TYVPLTDYAAWQNALQDNTRLLFLETPSNPLSEIADIARLGELARANQAWLVVDNCFCTP 189 Query: 201 ALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGEQMKEVV-GFLRTAGPTLSPFNAW 259 ALQ+PL LGAD+V+HSATK++DGQGR +GG V G + E + G +RTAGP++SPFNAW Sbjct: 190 ALQKPLTLGADLVVHSATKFLDGQGRVVGGAVVGPAALVDEKIRGVMRTAGPSMSPFNAW 249 Query: 260 LFLKGLETLRIRMQAHSASALALAEWLERQPGIERVYYAGLPSHPQHELARRQQSGFGAV 319 +FLKGLETL +RM+AHS A ALA+WL QP +++VY+ GL SHPQ L RQQSG G + Sbjct: 250 VFLKGLETLALRMKAHSEQAQALADWLVAQPAVKQVYFPGLASHPQRALIARQQSGPGGL 309 Query: 320 VSFDVKGGRDAAWRFIDATRMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSL 379 ++F+V GGR+AAW ID TRM+SIT NLGD KT+I HPATT+H R+S DR +GI +SL Sbjct: 310 LAFEVAGGREAAWTVIDQTRMISITANLGDVKTSITHPATTTHARVSQADREASGISESL 369 Query: 380 IRVAVGLEDLDDLKADMARGLAAL 403 +RV+VGLE ++D++AD+ARGL + Sbjct: 370 VRVSVGLEAIEDIQADLARGLGMI 393 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 445 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 399 Length adjustment: 31 Effective length of query: 372 Effective length of database: 368 Effective search space: 136896 Effective search space used: 136896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory